DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F44E5.2 and CG12084

DIOPT Version :9

Sequence 1:NP_496512.2 Gene:F44E5.2 / 185735 WormBaseID:WBGene00009689 Length:489 Species:Caenorhabditis elegans
Sequence 2:NP_612112.1 Gene:CG12084 / 192509 FlyBaseID:FBgn0043458 Length:793 Species:Drosophila melanogaster


Alignment Length:481 Identity:97/481 - (20%)
Similarity:179/481 - (37%) Gaps:156/481 - (32%)


- Green bases have known domain annotations that are detailed below.


 Worm    38 KLVALDIELDPNYCLQISRKLNITKAVCKNVTTEHIKLLSNNCILSLTIGNIDKVKQVYQDDKEN 102
            ||.||.:.    ||..||            |.:.|:.....:.:.||.:|....:.|..:.:::.
  Fly   109 KLFALSLW----YCDMIS------------VGSHHLLAHYGDSLRSLELGISSHLLQYAEPNEKE 157

 Worm   103 PI------INIARL-LEDVLGEESRQ-----NLQYLDIQGNELFSYNWPKALGHMLPSLQTLIVC 155
            |:      .::.|| |..|:.....|     :|.:||:....|.:::. :||| .||:|.|||:.
  Fly   158 PVDFQLTCPHLRRLVLNGVVMHHRLQFAHLHDLGHLDLTSCVLANFSL-EALG-SLPNLHTLILF 220

 Worm   156 QRSFINDEFSQLCNSFPNLHKLDISDTNIGNLSGISNLKNLQKLCMMNLEFESYDDIKELFEVKS 220
            ....|.::...:| ....|..||||.::.||..|                  :||...:..|:  
  Fly   221 NVWPIANQLHAIC-CLRRLCTLDISISSSGNGHG------------------TYDLPDQTLEM-- 264

 Worm   221 LRVLNISRDRKDFKPSLIMQYIQLKEVLPELRFLDCSGTNV------DKESIST--IQNSHPNLK 277
                                   |.:.|..|..||.||||:      .|||.:|  :|.| |.::
  Fly   265 -----------------------LMDNLRHLTHLDISGTNLAGNGVATKESTTTSGMQQS-PKME 305

 Worm   278 KVAALCE-PG----------------------KNFIVPEIKILNSIDLGSTLKCLEHYTTLKHD- 318
            :..||.: ||                      |...:|.:::....:....|....:|    || 
  Fly   306 QHFALTDIPGLASRTQRPLQFLGLYHTAHWACKRHDIPALEVAGDANEQQILTAARYY----HDR 366

 Worm   319 -VFMSQCLHALFNFIKSSYHIDNEWIQYVYRAINTCSS--------DNVQIQGGACLSLIVKKSI 374
             |.:::.|:.|::.    :..:|  .:.::.|::...|        .::||.|.|.|..|||...
  Fly   367 PVLLTRVLNDLYHL----FRFEN--CKDIHTALDVVLSAMDRHLKFKHMQISGSATLFYIVKGRD 425

 Worm   375 KTMRPYEVALSRVVCKGSVAKTFYNASKPNSWDLTVLERKVVSL--------------EVLKPIA 425
            ::.       ...:.:..:.:|..|..:.:..|.|:|....::|              .::|.:.
  Fly   426 RSK-------FGALLRNHIIRTLLNGMEMHITDDTMLRNGYLTLTQFHMPVDVLFEYERLIKILL 483

 Worm   426 YGIIVRD---------MCMINILNCK 442
            :|:...:         :.::|.|.|:
  Fly   484 HGVSKTEQEGFVQRIAIYLLNTLACQ 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F44E5.2NP_496512.2 leucine-rich repeat 123..148 CDD:275380 8/24 (33%)
leucine-rich repeat 149..173 CDD:275380 6/23 (26%)
LRR_4 172..215 CDD:289563 10/42 (24%)
leucine-rich repeat 174..195 CDD:275380 8/20 (40%)
CG12084NP_612112.1 leucine-rich repeat 110..135 CDD:275381 9/40 (23%)
leucine-rich repeat 136..167 CDD:275381 5/30 (17%)
leucine-rich repeat 168..189 CDD:275381 5/20 (25%)
leucine-rich repeat 190..213 CDD:275381 8/24 (33%)
ARM 535..628 CDD:237987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3665
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.