powered by:
Protein Alignment hlh-17 and CG33557
DIOPT Version :9
Sequence 1: | NP_502928.3 |
Gene: | hlh-17 / 185460 |
WormBaseID: | WBGene00001961 |
Length: | 101 |
Species: | Caenorhabditis elegans |
Sequence 2: | NP_001014730.1 |
Gene: | CG33557 / 3346145 |
FlyBaseID: | FBgn0053557 |
Length: | 150 |
Species: | Drosophila melanogaster |
Alignment Length: | 58 |
Identity: | 23/58 - (39%) |
Similarity: | 32/58 - (55%) |
Gaps: | 2/58 - (3%) |
- Green bases have known domain annotations that are detailed below.
Worm 16 RLSINLRERCRMHDLNEALDDLRAVIPYAHGGSVRKLSKIATLLLAKNHIIMQAKAIE 73
|..||.|||.|..::|.|.:.||.:||..... ||||||..:.||.::|...:..:|
Fly 63 RQKINARERYRTFNVNSAYEALRNLIPTEPMN--RKLSKIEIIRLASSYITHLSSTLE 118
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
42 |
1.000 |
Inparanoid score |
I4152 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.960 |
|
Return to query results.
Submit another query.