DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gst-14 and GstE9

DIOPT Version :9

Sequence 1:NP_496861.1 Gene:gst-14 / 185409 WormBaseID:WBGene00001762 Length:210 Species:Caenorhabditis elegans
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:198 Identity:50/198 - (25%)
Similarity:85/198 - (42%) Gaps:18/198 - (9%)


- Green bases have known domain annotations that are detailed below.


 Worm    10 PVRGLAESARLLFHLAGVPFEDERVNFL--DDTWEKMKGKTPMGQLPVLTVDDFEIPQSAAINRY 72
            |||    :.:|.....|:.:|...||.|  :...::...|.|...:|||..|...|.:|.||..|
  Fly    14 PVR----ACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESHAICAY 74

 Worm    73 LARKFGFAGKTPEEEAWVDAVVDQFKDF-----FAEFRKLVIAKRVGKSAEELEKLTAEVIKPAM 132
            |.|::..:.....::.:..|:|||...|     |....:.:......|:..|:.:...:.|..|.
  Fly    75 LVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRSQIDAIYEAY 139

 Worm   133 DVYFKVLNGLLEKSKSGYLIGDSITFADLYIADNIQTLKKYGLLEASGEQPKLAAHLEKVYSHPN 197
            | :.:...|     ...||.|..||.||..:..::.:|.....::|. ..|||...|:::.:.||
  Fly   140 D-FLEAFIG-----NQAYLCGPVITIADYSVVSSVSSLVGLAAIDAK-RYPKLNGWLDRMAAQPN 197

 Worm   198 LKS 200
            .:|
  Fly   198 YQS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gst-14NP_496861.1 GST_N_Sigma_like 4..75 CDD:239337 21/66 (32%)
PTZ00057 6..205 CDD:173353 50/198 (25%)
GST_C_Sigma_like 85..192 CDD:198301 25/111 (23%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 50/198 (25%)
GST_N_Delta_Epsilon 4..76 CDD:239343 20/65 (31%)
GST_C_Delta_Epsilon 92..209 CDD:198287 28/116 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.