DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F32D8.2 and CG31933

DIOPT Version :9

Sequence 1:NP_505771.2 Gene:F32D8.2 / 185204 WormBaseID:WBGene00009327 Length:568 Species:Caenorhabditis elegans
Sequence 2:NP_722734.1 Gene:CG31933 / 326176 FlyBaseID:FBgn0051933 Length:673 Species:Drosophila melanogaster


Alignment Length:474 Identity:100/474 - (21%)
Similarity:168/474 - (35%) Gaps:158/474 - (33%)


- Green bases have known domain annotations that are detailed below.


 Worm   112 SSDGYLTL-----RSKNTNDLPSD--IRCTFY----------KNSGPNEHPIKVEKNVPVKVPFY 159
            :.|.||.|     |....:||..|  |:|.::          |..||...|:  |....:|||  
  Fly    89 NGDWYLKLTRDIDRILQESDLTHDWQIKCYWFRIKIKGRWRAKIYGPTMFPL--EYPYALKVP-- 149

 Worm   160 NFAFACERNGI----VEFLKPFVN---------FASIP------------------KKSNGG--- 190
                    .|:    |:.|..|.|         |...|                  |.|:|.   
  Fly   150 --------KGLRHMRVKCLNTFTNKTLHDDAHFFIQPPPEKLLKKPPATLKYWDGEKHSSGATSP 206

 Worm   191 -SIAIIFLPAINHKLFMKKMPLSKHFMQDN--QFRFAQFMSKNEPNSMQDLL-LQLGIS------ 245
             |:.|:.|.:::|...:::||.:..:|:.|  |..|..| :|...|:..:|: |..|:|      
  Fly   207 ISVMILGLDSVSHLNLLRQMPRTVRYMRQNMSQVEFWGF-NKIGTNTYPNLIALLTGLSAAESEA 270

 Worm   246 ---------NKINMFRKAKQNNFTTFFSGPQQIRYMI-----DVDYDTLDHQNFITQFLIDGNLC 296
                     |...::::.|:..:.|.|:....|..|.     .....|.|  |.:..|::|  |.
  Fly   271 YWVRQKCMDNLPLIWKEFKRAGYNTSFAEDMAIYSMFYFGKPGFKRPTTD--NNLHDFMVD--LY 331

 Worm   297 LKNGKKLVNDQ------------LEKIGAFLTSTADSKVFS----AMFIDEYDEYRRQSIDQDLK 345
            :......|:|.            ||.....|..|.....||    |....|:....|.: |...:
  Fly   332 INRQASSVSDTHCMGERAFMDILLEMNDRLLPHTQRYPFFSFYWWANGFHEFFNSPRLA-DGRFE 395

 Worm   346 KMLDLLKESNIFENTTLIITSYDLSTKDIENENDKYPMFAFRPSNQFIENNNQK----LY--FMN 404
            ::|..|.::.|..||.:...|         :...::.:  ||.|.|.:..::|.    ||  :|.
  Fly   396 RLLRSLDDAGITNNTIIFFMS---------DHGLRWGL--FRSSFQGMIEDSQPFLSVLYPKWMR 449

 Worm   405 M-----------NFNRLLSSTNFNQMLVELINP----------------KEKSSK-----SVFIA 437
            :           |.:.|:::.:.::.|..::.|                |.|.|:     |:|:.
  Fly   450 LKYPMAIKSLVGNAHSLVTTYDLHETLKHILEPSSLEDTSITQKTEELWKLKGSQTPRAVSLFLP 514

 Worm   438 QPTSRNCTSEGISENICLC 456
            .|..|||.:..|....|||
  Fly   515 IPPWRNCNTSHIPSKFCLC 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F32D8.2NP_505771.2 DUF229 <324..463 CDD:281053 37/175 (21%)
CG31933NP_722734.1 DUF229 114..576 CDD:281053 92/449 (20%)
ALP_like 208..483 CDD:293745 58/291 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.