DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax4 and al

DIOPT Version :9

Sequence 1:NP_035168.1 Gene:Pax4 / 18506 MGIID:97488 Length:349 Species:Mus musculus
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:223 Identity:66/223 - (29%)
Similarity:90/223 - (40%) Gaps:36/223 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse   156 HSNCGAPRGPHPGTSHRNRTIFSPGQAEALEKEFQRGQYPDSVARGKLAAATSLPEDTVRVWFSN 220
            :|:|.|..........|.||.|:..|.|.|||.|.|..|||...|.:||....|.|..::|||.|
  Fly    71 NSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQN 135

Mouse   221 RRAKWRRQEKL-----KWEAQLPGASQDL------TVPKNSPGIISAQ-------QSPGSVPSAA 267
            ||||||:|||:     .:...|||.:..:      .:|.|....:..|       |...::.:..
  Fly   136 RRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHLGFQLRKPFDAQHAANLAAFR 200

Mouse   268 LPVLE--PLSPS--FCQLCCGTAP---------GRCSSDTSSQAYLQPYWDCQSLLPVASSSYVE 319
            .|.|.  |:.||  |.|.  ..||         |..|..:|.|:.|..........|:.....:.
  Fly   201 YPHLSAAPMIPSGYFNQF--QRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVPRGTPLGKPPALL 263

Mouse   320 FAWPCLTTHPVHHLIGGPGQVP-STHCS 346
            ...|.|  |..:|::..|...| |.|.|
  Fly   264 VGSPDL--HSPNHMLASPPTSPASGHAS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pax4NP_035168.1 PAX 5..129 CDD:128645
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 8..64
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 83..131
Homeobox 174..226 CDD:278475 26/51 (51%)
Transcription repression 278..349 19/79 (24%)
alNP_722629.1 Homeobox 89..141 CDD:278475 26/51 (51%)
OAR 374..391 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.