DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax3 and PHDP

DIOPT Version :10

Sequence 1:NP_001152992.1 Gene:Pax3 / 18505 MGIID:97487 Length:484 Species:Mus musculus
Sequence 2:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster


Alignment Length:44 Identity:11/44 - (25%)
Similarity:18/44 - (40%) Gaps:2/44 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse   302 SKRRNSNLQVICEKIFRPWFSPTLLGAKAGLPLQVELQRAVQEC 345
            :|.:||  :.:|..|...|.....:|:...|.|.....|:...|
  Fly   142 AKHKNS--RRVCLTILLVWAISAAIGSPIVLGLNNTQDRSPDLC 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pax3NP_001152992.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PAX 34..159 CDD:128645
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 37..93
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 113..161
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..228
Homeodomain 220..276 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..351 8/37 (22%)
Pax7 347..391 CDD:403540
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.