| Sequence 1: | NP_001152992.1 | Gene: | Pax3 / 18505 | MGIID: | 97487 | Length: | 484 | Species: | Mus musculus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_523834.1 | Gene: | PHDP / 37788 | FlyBaseID: | FBgn0025334 | Length: | 220 | Species: | Drosophila melanogaster |
| Alignment Length: | 44 | Identity: | 11/44 - (25%) |
|---|---|---|---|
| Similarity: | 18/44 - (40%) | Gaps: | 2/44 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Mouse 302 SKRRNSNLQVICEKIFRPWFSPTLLGAKAGLPLQVELQRAVQEC 345 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Pax3 | NP_001152992.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | ||
| PAX | 34..159 | CDD:128645 | |||
| PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 | 37..93 | ||||
| RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 | 113..161 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 165..228 | ||||
| Homeodomain | 220..276 | CDD:459649 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 309..351 | 8/37 (22%) | |||
| Pax7 | 347..391 | CDD:403540 | |||
| PHDP | NP_523834.1 | Homeodomain | 113..169 | CDD:459649 | 7/28 (25%) |
| Blue background indicates that the domain is not in the aligned region. | |||||