DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax1 and ey

DIOPT Version :9

Sequence 1:XP_006498974.1 Gene:Pax1 / 18503 MGIID:97485 Length:534 Species:Mus musculus
Sequence 2:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster


Alignment Length:398 Identity:148/398 - (37%)
Similarity:178/398 - (44%) Gaps:128/398 - (32%)


- Green bases have known domain annotations that are detailed below.


Mouse   137 RALPLCLSGGGGARALPDCAG-PSPRRSG--ARQLAGPRAM-------------EQTYGEVNQLG 185
            |.|| ||...||: .|...|| |||....  |...:.|.:.             ::.:..|||||
  Fly    43 RNLP-CLGTAGGS-GLGGIAGKPSPTMEAVEASTASHPHSTSSYFATTYYHLTDDECHSGVNQLG 105

Mouse   186 GVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPR 250
            ||||.|||||::.|.:|||||..|.|||||||.|:||:|||||||.||.|||||.|.||||||||
  Fly   106 GVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPR 170

Mouse   251 VTTPNVVKHIRDYKQGDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGSLAQPGPYEA 315
            |.|..||..|..||:..|.|||||||||||.:.||...|:||||||:|:|||    ||      |
  Fly   171 VATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLRN----LA------A 225

Mouse   316 SKQPPPQPALPYNHIYQYPYPSPVSPTGTKMGTHPGVPGSAGH-VSIPRSWPSAHSVSNILGIRT 379
            .|:             |....|..|.|            |||: :|...|.....:|||:     
  Fly   226 QKE-------------QQSTGSGSSST------------SAGNSISAKVSVSIGGNVSNV----- 260

Mouse   380 FMEQTGALAGSEGAAYSPKMEDWAGVNRAAFPTSPAVNGLEKPALEADIKYTQSASSLSAVGGFL 444
                   .:||.|...|                            ..|:..|.:..:.|..||  
  Fly   261 -------ASGSRGTLSS----------------------------STDLMQTATPLNSSESGG-- 288

Mouse   445 PACAYPASN------QHGVY-------SAPAAGYLSPGPPWPPAQAPPL---TPHGAGV------ 487
                  |||      |..:|       :..|||   || |..||:|.||   :|:..|.      
  Fly   289 ------ASNSGEGSEQEAIYEKLRLLNTQHAAG---PG-PLEPARAAPLVGQSPNHLGTRSSHPQ 343

Mouse   488 AVHGGELA 495
            .|||...|
  Fly   344 LVHGNHQA 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pax1XP_006498974.1 PAX 177..304 CDD:238076 86/126 (68%)
eyNP_001014693.1 PAX 98..221 CDD:128645 83/122 (68%)
Homeobox 475..527 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.