DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP8 and Mkp3

DIOPT Version :9

Sequence 1:NP_004411.2 Gene:DUSP8 / 1850 HGNCID:3074 Length:625 Species:Homo sapiens
Sequence 2:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster


Alignment Length:467 Identity:124/467 - (26%)
Similarity:191/467 - (40%) Gaps:149/467 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    11 MDAKKLASLLRGGPGGPLVIDSRSFVEYNSWHVLSSVNICCSKLVKRRLQQGKVTIAELIQ-PAA 74
            :|:|.|           :::|.|...||:..|:..:||:|...:|.|||..||:.:|..|: |..
  Fly    21 LDSKDL-----------ILLDCRGSHEYSESHIRGAVNLCIPSIVLRRLAVGKIDLASTIKSPEL 74

Human    75 RSQVEA---------TEPQDVVVYDQSTRDASVLAA--DSFLSILLSKL--DGCFDSVAILTGGF 126
            :.::::         ...:.|...:|....|..||.  ||.:|||..:|  |||  .|..|..||
  Fly    75 KQRIQSGYKLCWFILYNGEGVPGQNQEIAGAGSLAVAMDSIISILHRRLKQDGC--RVVALQDGF 137

Human   127 ATFSSCFPGLCEG--------------------------------KPAALLPMSLSQPC------ 153
            ..|...||..||.                                ..:|....:.|..|      
  Fly   138 NNFRQAFPEWCEDDNQTHSKEIESSRNVQTDQLMGLRSLRISTTQSDSACSSSAESSDCESSSHH 202

Human   154 -----------LPVPSVGLTRILPH-LYLGSQKDVLNKDLMTQNGISYVLNASNSCPKPDFICES 206
                       .||      .|:|. |:||:.....:.:.:.:..|.||||.:...|..  ..||
  Fly   203 HHHHSHHNYNEAPV------EIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNK--FKES 259

Human   207 ---RFMRVPINDNYCEKLLPWLDKSIEFIDKAKLSSCQVIVHCLAGISRSATIAIAYIMKTMGMS 268
               :::::||.|:|.:.|......:|:||::|:.:|..|:||||||:|||.|:.:||:|.|.|:|
  Fly   260 GDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLS 324

Human   269 SDDAYRFVKDRRPSISPNFNFLGQLLEYERSLKL---------------------------LAAL 306
            .:||:..|:||:|.:||||:|:.|||.:|..|:|                           ||..
  Fly   325 LNDAFAMVRDRKPDVSPNFHFMQQLLSFESQLRLRPGSRFSCSCIAPDCNCMQTTGFMATHLANA 389

Human   307 QG---------DPGTPSGT-----------------PEPPPSPAAGAPLP--------RLPPPTS 337
            .|         |..|||.|                 .|.|.:.||.:|||        .:.|.::
  Fly   390 TGVSPDSGIEFDRWTPSDTGLKXEQSGGKSFVLPPSQEVPFAAAATSPLPMCLAVNPDNMSPAST 454

Human   338 ESAATGNAAARE 349
            .|::|......|
  Fly   455 TSSSTSTTTTAE 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP8NP_004411.2 DSP_MapKP 10..137 CDD:238723 41/139 (29%)
DSPc 160..297 CDD:238073 54/140 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..586 17/78 (22%)
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723 41/139 (29%)
DSPc 215..353 CDD:238073 56/145 (39%)
CDC14 <242..359 CDD:225297 51/118 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.