DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP8 and CG10089

DIOPT Version :9

Sequence 1:NP_004411.2 Gene:DUSP8 / 1850 HGNCID:3074 Length:625 Species:Homo sapiens
Sequence 2:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster


Alignment Length:499 Identity:121/499 - (24%)
Similarity:178/499 - (35%) Gaps:134/499 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   163 RILPHLYLGSQKDVLNKDLMTQNGISYVLNASNS----CPKPDFICESRFMRVPINDNYCEKLLP 223
            ::||.||:|:.:|..:...:.:..||:::...:|    .|...::|      |..:|...:.|..
  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDKHYLC------VMASDTPDQNLSQ 65

Human   224 WLDKSIEFIDKAKLSSCQVIVHCLAGISRSATIAIAYIMKTMGMSSDDAYRFVKDRRPSISPNFN 288
            :.....:||..|:|....|::|||||:|||.|:|:||||....::..:|.:.|:..|...:||..
  Fly    66 YFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAG 130

Human   289 FLGQLLEYE--------RSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATG-- 343
            |..||.|:|        |.|:                |..||.|    |.:|......:|...  
  Fly   131 FQSQLQEFE
QFKLSEERRRLR----------------ERFPSSA----LEQLDRTKVATALDNYQ 175

Human   344 ----NAAAREGGLSAGGEPPA-----PPTP------PATSALQQGLRGLHLSSDRLQDTNRLKRS 393
                |....||..|.|.:.|.     .||.      |:.::....||.        |.:|....|
  Fly   176 ELLQNRDICEGNCSRGEKCPTGVCNMDPTKGLFRRRPSNASTHSRLRA--------QSSNANASS 232

Human   394 FSLDIKSAYAPSRRPDGPGPPDPGEAPKLCKLDSPSGAALG-----LSSPSPDSPDAA------P 447
            .||.:.||.|.|      .|..|..:|......|.....:.     |..|...|.:||      .
  Fly   233 SSLSVSSAAAQS------CPTSPKNSPLPIVRRSVGNERIPEDEIVLEQPPTTSREAAEYAAAFE 291

Human   448 EAR--------------PRPRRRPRP-----------PAGSPARSPAHSLGLNFGDAARQTPRHG 487
            :||              .|.:|.|||           .|||...|.|..     |:.:.|..| .
  Fly   292 DARREQEQRQLQQQQQLSRSQRSPRPVNSSREAPRVSSAGSRRESAARE-----GNGSAQLQR-S 350

Human   488 LSALSAPGLPGPGQPAGPGAWAPPLDSPGTPSPDGPWCFSPEGAQGAGGVLFAPFGRA------G 546
            .|.:|..|:.....|||..|:...:.|    |..|......:..:|:...|.....||      .
  Fly   351 ASTVSGFGVRPRSSPAGLHAYTGSVPS----SVHGSRVDLRDADKGSAIYLGCSAPRASTLSISS 411

Human   547 APGPGGGSDLRRREAARAEPRDARTGWPEEPAPETQFKRRSCQM 590
            :.|..|||         |.|....|    .||......:||..:
  Fly   412 SRGSSGGS---------APPSPCHT----PPASPRHGVKRSTSL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP8NP_004411.2 DSP_MapKP 10..137 CDD:238723
DSPc 160..297 CDD:238073 42/137 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..586 74/338 (22%)
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 42/137 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.