DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP7 and puc

DIOPT Version :9

Sequence 1:NP_001938.2 Gene:DUSP7 / 1849 HGNCID:3073 Length:419 Species:Homo sapiens
Sequence 2:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster


Alignment Length:269 Identity:91/269 - (33%)
Similarity:133/269 - (49%) Gaps:40/269 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   149 APASVLGLLLQKLRDDGCQAYYLQGGFNKFQTEY-SEHCETNVDSSSSPSSSPPTSVLGLGGLRI 212
            ||..:|.:.:|...::.      :.|.|  |.:| ::....|:......|::..::.:..||   
  Fly    59 APCLLLFMPIQNTNNNN------RIGAN--QKDYPNKRSRENLACDEVTSTTSSSTAMNGGG--- 112

Human   213 SSDCSDGESDRELPSSATESDGSPVP---SSQPAFPVQILPYLYLGCAKDSTNLDVLGKYGIKYI 274
                       ..| :.|.|..||..   .:.||.||  .|:|.||..:|:   |.....|...:
  Fly   113 -----------RTP-ALTRSCSSPAVYDIETHPASPV--FPHLLLGNGRDA---DDPSSVGANCV 160

Human   275 LNVTPNLPNAFEHGGEFTYKQIPISDHWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSV 339
            ||||...||. .|.....|.|||.||...||:.|:|.||..||::||.....||:||.||||||.
  Fly   161 LNVTCQSPNE-SHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSA 224

Human   340 TVTVAYLMQKMNLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTL---GLSSPCDNHASSEQLY 401
            |:.:||:|:..:|||.:||..||..:..||||.|||||||:.|:.|   |:.:|...|.:|.   
  Fly   225 TIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNSP--- 286

Human   402 FSTPTNHNL 410
             |.|::.::
  Fly   287 -SNPSSSSV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP7NP_001938.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
DSP_MapKP 55..186 CDD:238723 8/37 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..240 5/26 (19%)
DSP_DUSP7 240..388 CDD:350491 69/150 (46%)
Substrate binding. /evidence=ECO:0000269|PubMed:26057789, ECO:0007744|PDB:4Y2E 331..337 4/5 (80%)
pucNP_524273.1 DSPc 133..267 CDD:238073 66/139 (47%)
CDC14 <193..272 CDD:225297 42/78 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.