DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP7 and CG10089

DIOPT Version :9

Sequence 1:NP_001938.2 Gene:DUSP7 / 1849 HGNCID:3073 Length:419 Species:Homo sapiens
Sequence 2:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster


Alignment Length:141 Identity:54/141 - (38%)
Similarity:83/141 - (58%) Gaps:11/141 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   247 QILPYLYLGCAKDSTNLDVLGKYGIKYILNV--TPN--LPNAFEHGGEFTYKQIPISDHWSQNLS 307
            ::||.||:|..:||.:...|.::.|.:|:.:  :|.  ||:  :|     |..:..||...||||
  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPD--KH-----YLCVMASDTPDQNLS 64

Human   308 QFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQKMNLSLNDAYDFVKRKKSNISPNF 372
            |:|.....||..||.::..||:|||||:||||||.|||:|...:|:..:|...|:..::..:||.
  Fly    65 QYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNA 129

Human   373 NFMGQLLDFER 383
            .|..||.:||:
  Fly   130 GFQSQLQEFEQ 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP7NP_001938.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
DSP_MapKP 55..186 CDD:238723
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..240
DSP_DUSP7 240..388 CDD:350491 54/141 (38%)
Substrate binding. /evidence=ECO:0000269|PubMed:26057789, ECO:0007744|PDB:4Y2E 331..337 4/5 (80%)
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 52/138 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.