DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP6 and puc

DIOPT Version :9

Sequence 1:NP_001937.2 Gene:DUSP6 / 1848 HGNCID:3072 Length:381 Species:Homo sapiens
Sequence 2:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster


Alignment Length:213 Identity:86/213 - (40%)
Similarity:115/213 - (53%) Gaps:15/213 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   173 SSDSSSDIESDLDRDPNSATDSDGSPL---SNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIK 234
            |:.|||...:...|.| :.|.|..||.   ..:.|:.||  .|.|.||..:|:   |.....|..
  Fly   100 STTSSSTAMNGGGRTP-ALTRSCSSPAVYDIETHPASPV--FPHLLLGNGRDA---DDPSSVGAN 158

Human   235 YILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISR 299
            .:||||...||.....| .||.|||.||...||:.|:|.||..||::||.....||:||.|||||
  Fly   159 CVLNVTCQSPNESHLQG-LKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISR 222

Human   300 SVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQQLYF 364
            |.|:.:||:|:..:||:.:||.:||:.:..||||.|||||||:.|:.|..|.......|    :.
  Fly   223 SATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATP----HL 283

Human   365 TTPSNQNVYQVD-SLQST 381
            .:|||.:...|. |.||:
  Fly   284 NSPSNPSSSSVGLSTQSS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP6NP_001937.2 DSP_MapKP 17..147 CDD:238723
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..203 9/29 (31%)
DSPc 207..344 CDD:238073 64/136 (47%)
pucNP_524273.1 DSPc 133..267 CDD:238073 65/139 (47%)
CDC14 <193..272 CDD:225297 41/78 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.