DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak1 and hpo

DIOPT Version :9

Sequence 1:NP_001344291.1 Gene:Pak1 / 18479 MGIID:1339975 Length:552 Species:Mus musculus
Sequence 2:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster


Alignment Length:306 Identity:117/306 - (38%)
Similarity:184/306 - (60%) Gaps:16/306 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse   251 KKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPK 315
            |..|:|:|.:|:         .|:|.:....|:|:|:.|:||.|:...:...||||.:.::....
  Fly    25 KLKKLSEESLLQ---------PPEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLH 80

Mouse   316 KELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDV--VTETCMDEGQIAAVCR 378
            :  ||.||.:|::..:|.:|.|..||....:||:.|||...||::|:  :.:..:.|.:||.:..
  Fly    81 E--IIKEISIMQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILS 143

Mouse   379 ECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVV 443
            :.||.|.:||..:.||||||:.||||..:|..||.|||...|:|...:||:|::|||:||||||:
  Fly   144 DTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI 208

Mouse   444 TRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRC 508
            ....|....|||||||.|:||.||:|||...:|:||:::|.....|..:.|::.|..|.||:::|
  Fly   209 EEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKC 273

Mouse   509 LEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLI---AAAKEATKNN 551
            |..:.:.|.:|.|||:|:|::.||..|.|.|::   .|.:|..:.|
  Fly   274 LVKEPDDRATATELLEHEFIRNAKHRSILKPMLEETCAIREQQRAN 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak1NP_001344291.1 PBD 74..128 CDD:334253
STKc_PAK1 256..551 CDD:270820 114/299 (38%)
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 103/256 (40%)
S_TKc 42..293 CDD:214567 101/252 (40%)
Mst1_SARAH 608..655 CDD:288481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.