DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP5 and CG10089

DIOPT Version :9

Sequence 1:NP_004410.3 Gene:DUSP5 / 1847 HGNCID:3071 Length:384 Species:Homo sapiens
Sequence 2:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster


Alignment Length:205 Identity:60/205 - (29%)
Similarity:89/205 - (43%) Gaps:45/205 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   181 EILPFLYLGSAYHASK----CEFLANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADISSH 241
            ::||.||:|: |..||    .|.....||.|:.:..||    .....||..:...|:...::|.:
  Fly     7 KVLPGLYVGN-YRDSKDHAQLERFKISHIIAIHDSPRR----LLPDKHYLCVMASDTPDQNLSQY 66

Human   242 FQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMKTKQFRLKEAFDYIKQRRSMVSPNFGF 306
            |....|||...|.:.|.||:||.||:|||.|:.:||:|.......|||...::..|::.:||.||
  Fly    67 FSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGF 131

Human   307 MGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVS 371
            ..||.::|.                           ..||.:.:.....||:|.|         .
  Fly   132 QSQLQEFEQ---------------------------FKLSEERRRLRERFPSSAL---------E 160

Human   372 ELSRSPVATA 381
            :|.|:.||||
  Fly   161 QLDRTKVATA 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP5NP_004410.3 DSP_MapKP 5..140 CDD:238723
Nuclear localization signal. /evidence=ECO:0000255 53..74
DSPc 178..314 CDD:238073 47/136 (35%)
CDC14 <227..311 CDD:225297 30/83 (36%)
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 47/136 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.