Sequence 1: | NP_004410.3 | Gene: | DUSP5 / 1847 | HGNCID: | 3071 | Length: | 384 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261803.1 | Gene: | CG10089 / 39517 | FlyBaseID: | FBgn0036369 | Length: | 447 | Species: | Drosophila melanogaster |
Alignment Length: | 205 | Identity: | 60/205 - (29%) |
---|---|---|---|
Similarity: | 89/205 - (43%) | Gaps: | 45/205 - (21%) |
- Green bases have known domain annotations that are detailed below.
Human 181 EILPFLYLGSAYHASK----CEFLANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADISSH 241
Human 242 FQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMKTKQFRLKEAFDYIKQRRSMVSPNFGF 306
Human 307 MGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVS 371
Human 372 ELSRSPVATA 381 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DUSP5 | NP_004410.3 | DSP_MapKP | 5..140 | CDD:238723 | |
Nuclear localization signal. /evidence=ECO:0000255 | 53..74 | ||||
DSPc | 178..314 | CDD:238073 | 47/136 (35%) | ||
CDC14 | <227..311 | CDD:225297 | 30/83 (36%) | ||
CG10089 | NP_001261803.1 | DSPc | 4..139 | CDD:238073 | 47/136 (35%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1716 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1576308at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |