DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP4 and puc

DIOPT Version :9

Sequence 1:NP_001385.1 Gene:DUSP4 / 1846 HGNCID:3070 Length:394 Species:Homo sapiens
Sequence 2:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster


Alignment Length:366 Identity:103/366 - (28%)
Similarity:151/366 - (41%) Gaps:98/366 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   114 RAESLREDSTVSLVVQALRRNAERTDICLL-------KGGYERFSS---EYPEFCSKTKALAAIP 168
            |.|...:..:||.:...::...:|...|||       .....|..:   :||...|: :.||...
  Fly    34 RCECDGDGDSVSHIQSEMKMRIKREAPCLLLFMPIQNTNNNNRIGANQKDYPNKRSR-ENLACDE 97

Human   169 PPVPPSATEPLDLG------CSSCGTP-LHD-QGGPVE-ILPFLYLGSAYHAARRDMLDALGITA 224
            .....|::..::.|      ..||.:| ::| :..|.. :.|.|.||:...|   |...::|...
  Fly    98 VTSTTSSSTAMNGGGRTPALTRSCSSPAVYDIETHPASPVFPHLLLGNGRDA---DDPSSVGANC 159

Human   225 LLNVSSDCPN--HFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRS 287
            :|||:...||  |.:| .:|..||..|....:|..:|.||.::|:..:....|||:||.||||||
  Fly   160 VLNVTCQSPNESHLQG-LKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRS 223

Human   288 ATICLAYLMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEAA----SPSG 348
            |||.:||:|..|.:.|.||::.||..|.|||||.:||||||:.|..:..:...|.|.    |||.
  Fly   224 ATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNSPSN 288

Human   349 P-------------------------LRERGKT-------------------------------- 356
            |                         .|||||:                                
  Fly   289 PSSSSVGLSTQSSQLVEQPEEEEKREQRERGKSKSDSEAMDEDGFDYDDVDSGSGSLAGSNCSSR 353

Human   357 ----PATPTSQFVFSFPVSVGVHSAPSSLPYLHSPITTSPS 393
                |.||..:       :....:|.||:..|.||.:||.|
  Fly   354 LTSPPITPDDE-------APSTSAAASSVSELDSPSSTSSS 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP4NP_001385.1 DSP_MapKP 9..158 CDD:238723 11/53 (21%)
DSPc 195..331 CDD:238073 59/138 (43%)
pucNP_524273.1 DSPc 133..267 CDD:238073 59/137 (43%)
CDC14 <193..272 CDD:225297 40/78 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.