DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP4 and Mkp3

DIOPT Version :9

Sequence 1:NP_001385.1 Gene:DUSP4 / 1846 HGNCID:3070 Length:394 Species:Homo sapiens
Sequence 2:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster


Alignment Length:442 Identity:130/442 - (29%)
Similarity:200/442 - (45%) Gaps:105/442 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    46 LLLDCRPFLAHSAGYILGSVNVRCNTIV-RRRAKGSVSLEQILPAEEEVRARLRSG-------LY 102
            :|||||....:|..:|.|:||:...:|| ||.|.|.:.|...:.: .|::.|::||       ||
  Fly    27 ILLDCRGSHEYSESHIRGAVNLCIPSIVLRRLAVGKIDLASTIKS-PELKQRIQSGYKLCWFILY 90

Human   103 SAVIVYDERSPRAE----SLREDSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCS---- 159
            :...|..:....|.    ::..||.:|::.:.|:::..|  :..|:.|:..|...:||:|.    
  Fly    91 NGEGVPGQNQEIAGAGSLAVAMDSIISILHRRLKQDGCR--VVALQDGFNNFRQAFPEWCEDDNQ 153

Human   160 ------------KTKALAAIPPPVPPSATEPLDLGCSS------CGTPLHD---------QGGPV 197
                        :|..|..: ..:..|.|:. |..|||      |.:..|.         ...||
  Fly   154 THSKEIESSRNVQTDQLMGL-RSLRISTTQS-DSACSSSAESSDCESSSHHHHHHSHHNYNEAPV 216

Human   198 EILP-FLYLGSAYHAARRDMLDALGITALLNVSSDCPNHFE--GHYQYKCIPVEDNHKADISSWF 259
            ||:| .|:||:|.|:...:.|....|..:|||:.|.||.|:  |..:|..||:.|::..|::..|
  Fly   217 EIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHF 281

Human   260 MEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKRVRLEEAFEFVKQRRSIISPNFSFM 324
            .:||::|:..:.....|||||.||:|||.|:.|||||..:.:.|.:||..|:.|:..:||||.||
  Fly   282 PDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFM 346

Human   325 GQLLQFESQV-------------------------LATSCA-AEAASPSGPL------------- 350
            .|||.||||:                         :||..| |...||...:             
  Fly   347 QQLLSFESQLRLRPGSRFSCSCIAPDCNCMQTTGFMATHLANATGVSPDSGIEFDRWTPSDTGLK 411

Human   351 --RERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYL-------HSPITTSPS 393
              :..||:...|.||.|   |.:.   :|.|.||..       .||.:|:.|
  Fly   412 XEQSGGKSFVLPPSQEV---PFAA---AATSPLPMCLAVNPDNMSPASTTSS 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP4NP_001385.1 DSP_MapKP 9..158 CDD:238723 35/123 (28%)
DSPc 195..331 CDD:238073 59/138 (43%)
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723 35/123 (28%)
DSPc 215..353 CDD:238073 59/137 (43%)
CDC14 <242..359 CDD:225297 52/116 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.