DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F16F9.1 and CG32280

DIOPT Version :9

Sequence 1:NP_509434.2 Gene:F16F9.1 / 184573 WormBaseID:WBGene00017513 Length:157 Species:Caenorhabditis elegans
Sequence 2:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster


Alignment Length:160 Identity:47/160 - (29%)
Similarity:63/160 - (39%) Gaps:39/160 - (24%)


- Green bases have known domain annotations that are detailed below.


 Worm     2 PESPPPSYS---PRRPPPPYEEQNNRNAKKESTMGTPEHHYKVSP-PPFVPLTQPTVIDVEQLQN 62
            |.|.||.::   |...||.|:|          .:|      .|.| .|:.|              
  Fly     4 PGSAPPQFTYVPPPSAPPSYQE----------AVG------GVKPVGPYTP-------------- 38

 Worm    63 VVLPGGQPNPTVVIVTTPKPAPSFASYETTCYSCGKYVHTLPKFVIGSLTWIVFILVLI--CFFP 125
            ||.|....|.|  ||||..|. |..|....|.||...:.|..:...|.:.::...|:.:  |:..
  Fly    39 VVAPATTANTT--IVTTVVPI-SRTSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLG 100

 Worm   126 LAFVPFCLDSCKDAHHYCPRCNALLGIKKR 155
            ...:|.|:|.|.|.||.||.|.|.||..:|
  Fly   101 CCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F16F9.1NP_509434.2 zf-LITAF-like 88..154 CDD:371158 21/67 (31%)
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 21/68 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CY6X
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.