DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P4hb and CaBP1

DIOPT Version :9

Sequence 1:NP_035162.1 Gene:P4hb / 18453 MGIID:97464 Length:509 Species:Mus musculus
Sequence 2:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster


Alignment Length:444 Identity:99/444 - (22%)
Similarity:140/444 - (31%) Gaps:220/444 - (49%)


- Green bases have known domain annotations that are detailed below.


Mouse    26 DNVLVLKKSNFE-EALAAHKYLLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEE 89
            |.|:.|..|||: |.|......:|||||||||||::|.|||.|.|..||   ..:::..|:|..:
  Fly    25 DGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALK---GVVKVGSVNADAD 86

Mouse    90 SDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLSDTAAAESLVDS 154
            |.|:.|:||||:||||.| ..:..||.:|...|               .|..:::.|.||  |..
  Fly    87 STLSGQFGVRGFPTIKIF-GANKKSPTDYNGQR---------------TAKAIAEAALAE--VKK 133

Mouse   155 SEVTVIGFFKDVESDSAKQFLLAAEAIDDIPFGITSNSGVFSKYQLDKDGVVLFKKFDEGRNNFE 219
            ....|:|                        .|..|:||                    |..:..
  Fly   134 KVQGVLG------------------------GGGGSSSG--------------------GSGSSS 154

Mouse   220 GEITKEKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSSFKRAAEGF 284
            |:.                |||.||.                                       
  Fly   155 GDD----------------VIELTED--------------------------------------- 164

Mouse   285 KGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCHRFL 349
                                                                             
  Fly   165 ----------------------------------------------------------------- 164

Mouse   350 EGKIKPHLMSQEVPEDWDKQPVKVLVGANFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGE 414
                                        ||:::..:......|||:||||||||.|||.|.|..:
  Fly   165 ----------------------------NFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAK 201

Mouse   415 TYKDHENIIIAKMDSTANEVEAVK--VHSFPTLKFFPASADRT--VIDYNGERT 464
            ..|.  .:.:..:|:||::.:|.:  |..:||:|||||.:.|.  ..:|:|.||
  Fly   202 ELKG--KVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRT 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P4hbNP_035162.1 ER_PDI_fam 26..476 CDD:273457 99/444 (22%)
Thioredoxin_like 31..135 CDD:294274 43/104 (41%)
PDI_b_family 139..234 CDD:239279 13/94 (14%)
PDI_b'_family 246..349 CDD:239280 0/102 (0%)
PDI_a_PDI_a'_C 370..472 CDD:239293 36/99 (36%)
Prevents secretion from ER 506..509
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 44/111 (40%)
PDI_a_P5 157..262 CDD:239299 41/247 (17%)
Thioredoxin_6 190..383 CDD:290560 24/66 (36%)
P5_C 271..400 CDD:239281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.