DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP3 and Mkp3

DIOPT Version :9

Sequence 1:NP_004081.1 Gene:DUSP3 / 1845 HGNCID:3069 Length:185 Species:Homo sapiens
Sequence 2:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster


Alignment Length:157 Identity:52/157 - (33%)
Similarity:82/157 - (52%) Gaps:16/157 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    32 EVTP-RIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSG-ITYLGIKANDTQ 94
            |:.| .:::|||:.:.|...|:|..|.:|||.....        .|.:|:|| |.||.|...|..
  Fly   217 EIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDL--------PNKFKESGDIKYLQIPITDHY 273

Human    95 EFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNR- 158
            ..:|:.:|..|..||::| ...:..|||||..|.|||.|:.:||||..:.:.:..|.::||..: 
  Fly   274 SQDLAIHFPDAIQFIEEA-RSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKP 337

Human   159 EIGPNDGFLAQLCQLNDRLAKEGKLKP 185
            ::.||..|:.||.....:|    :|:|
  Fly   338 DVSPNFHFMQQLLSFESQL----RLRP 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP3NP_004081.1 DUSP3 10..177 CDD:350427 49/147 (33%)
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 49/144 (34%)
CDC14 <242..359 CDD:225297 42/129 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.