DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP3 and CG10089

DIOPT Version :9

Sequence 1:NP_004081.1 Gene:DUSP3 / 1845 HGNCID:3069 Length:185 Species:Homo sapiens
Sequence 2:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster


Alignment Length:151 Identity:53/151 - (35%)
Similarity:83/151 - (54%) Gaps:13/151 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    32 EVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEF 96
            :|.|.:||||...::|..:|::..|:|::       .:| ::......|.  .||.:.|:||.:.
  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHII-------AIH-DSPRRLLPDK--HYLCVMASDTPDQ 61

Human    97 NLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREI- 160
            |||.||....||| .|...:.|.||:||..|.|||.|:.:||:|....::.|.||.:||..|.: 
  Fly    62 NLSQYFSVCNDFI-HAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVA 125

Human   161 GPNDGFLAQLCQLND-RLAKE 180
            .||.||.:||.:... :|::|
  Fly   126 NPNAGFQSQLQEFEQFKLSEE 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP3NP_004081.1 DUSP3 10..177 CDD:350427 51/146 (35%)
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 51/142 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.