DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP3 and CG7378

DIOPT Version :10

Sequence 1:NP_004081.1 Gene:DUSP3 / 1845 HGNCID:3069 Length:185 Species:Homo sapiens
Sequence 2:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster


Alignment Length:161 Identity:69/161 - (42%)
Similarity:97/161 - (60%) Gaps:11/161 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    30 CNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFY----------KDSGIT 84
            |:||.|.||:|:|:.|::...|:.:|||||||||||..:..|:|..::|          ||....
  Fly    71 CDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFR 135

Human    85 YLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKS 149
            |:|....|....::|.||..|:.|||.|:: ..|::||||..|.|||.|.|:||||:.:||....
  Fly   136 YMGFPMVDAPTTDISRYFYVASKFIDSAIS-SGGKILVHCLVGMSRSATCVLAYLMICRKMSAVD 199

Human   150 ALSIVRQNREIGPNDGFLAQLCQLNDRLAKE 180
            |:..||..|:|.||||||.||..|:..|.::
  Fly   200 AIRTVRMRRDIRPNDGFLQQLADLDMELKRK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP3NP_004081.1 DUSP3 10..177 CDD:350427 68/156 (44%)
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 68/156 (44%)

Return to query results.
Submit another query.