DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP2 and puc

DIOPT Version :9

Sequence 1:XP_016859035.1 Gene:DUSP2 / 1844 HGNCID:3068 Length:342 Species:Homo sapiens
Sequence 2:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster


Alignment Length:246 Identity:83/246 - (33%)
Similarity:119/246 - (48%) Gaps:33/246 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   104 DSPAHVLLAALLHETRAGPTAVYFL------RGEQAGRPWPAPPDSSPAFPADRALPLLAGGFDG 162
            ||.:|:.....:...|..|..:.|:      ...:.|.       :...:|..|:...||     
  Fly    42 DSVSHIQSEMKMRIKREAPCLLLFMPIQNTNNNNRIGA-------NQKDYPNKRSRENLA----- 94

Human   163 FQGCCPDLCSEAPAPALPPTGDKT---SRSDSRAPVYD-QGGPVE-ILPYLFLGSCSHSSDLQGL 222
                |.::.|...:......|.:|   :||.|...||| :..|.. :.|:|.||   :..|....
  Fly    95 ----CDEVTSTTSSSTAMNGGGRTPALTRSCSSPAVYDIETHPASPVFPHLLLG---NGRDADDP 152

Human   223 QACGITAVLNVSASCPN--HFEGLFRYKSIPVEDNQMVEISAWFQEAIGFIDWVKNSGGRVLVHC 285
            .:.|...||||:...||  |.:|| :|..||..|.....|..:||||..||:..:.:|.|||:||
  Fly   153 SSVGANCVLNVTCQSPNESHLQGL-KYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHC 216

Human   286 QAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFE 336
            .|||||||||.:||:|:.:.:.|.||:..||..|.:||||.:||||||:.|
  Fly   217 HAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP2XP_016859035.1 None
pucNP_524273.1 DSPc 133..267 CDD:238073 61/137 (45%)
CDC14 <193..272 CDD:225297 41/75 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.