DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP2 and Mkp3

DIOPT Version :9

Sequence 1:XP_016859035.1 Gene:DUSP2 / 1844 HGNCID:3068 Length:342 Species:Homo sapiens
Sequence 2:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster


Alignment Length:379 Identity:110/379 - (29%)
Similarity:166/379 - (43%) Gaps:106/379 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    23 EAERTLLLDCRPFLAFCRRHVRAA--RPVPWNALLRRRARGPPAAVLACLLPDRALRTRLVRG-- 83
            :::..:|||||....:...|:|.|  ..:| :.:|||.|.|  ...||..:....|:.|:..|  
  Fly    22 DSKDLILLDCRGSHEYSESHIRGAVNLCIP-SIVLRRLAVG--KIDLASTIKSPELKQRIQSGYK 83

Human    84 -----------------ELARAVVLDEGSASVAELRPDSPAHVLLAALLHETRAGPTAVYFLRGE 131
                             |:|.|     ||.:||   .||     :.::||.           |.:
  Fly    84 LCWFILYNGEGVPGQNQEIAGA-----GSLAVA---MDS-----IISILHR-----------RLK 124

Human   132 QAGRPWPAPPDSSPAFPADRALPLLAGGFDGFQGCCPDLCSE-----------------APAPAL 179
            |.|                ..:..|..||:.|:...|:.|.:                 .....|
  Fly   125 QDG----------------CRVVALQDGFNNFRQAFPEWCEDDNQTHSKEIESSRNVQTDQLMGL 173

Human   180 PPTGDKTSRSDSRAPV---------------------YDQGGPVEILP-YLFLGSCSHSSDLQGL 222
            ......|::|||....                     |:: .||||:| .||||:.:||.|.:.|
  Fly   174 RSLRISTTQSDSACSSSAESSDCESSSHHHHHHSHHNYNE-APVEIIPGLLFLGNATHSCDSEAL 237

Human   223 QACGITAVLNVSASCPNHFE--GLFRYKSIPVEDNQMVEISAWFQEAIGFIDWVKNSGGRVLVHC 285
            :...|..||||:...||.|:  |..:|..||:.|:...:::..|.:||.||:..:::...|||||
  Fly   238 KKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHC 302

Human   286 QAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFETQV 339
            .||:|||.|:.|||||.:|.:.|::||..|:.|:..:||||.||.|||.||:|:
  Fly   303 LAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFESQL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP2XP_016859035.1 None
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723 38/168 (23%)
DSPc 215..353 CDD:238073 62/137 (45%)
CDC14 <242..359 CDD:225297 52/115 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X468
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.