DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP1 and Mkp3

DIOPT Version :9

Sequence 1:NP_004408.1 Gene:DUSP1 / 1843 HGNCID:3064 Length:367 Species:Homo sapiens
Sequence 2:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster


Alignment Length:438 Identity:134/438 - (30%)
Similarity:197/438 - (44%) Gaps:103/438 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    25 LLLDCRSFFAFNAGHIAGSVNVRFSTIV-RRRAKGAMGLEHIVPNAELRGRLLAGAYHAVVLLDE 88
            :|||||....::..||.|:||:...:|| ||.|.|.:.|...:.:.||:.|:.:| |.....:..
  Fly    27 ILLDCRGSHEYSESHIRGAVNLCIPSIVLRRLAVGKIDLASTIKSPELKQRIQSG-YKLCWFILY 90

Human    89 RSAALDGAKRD----GTLALAAGAL------------CREARAAQVFFLKGGYEAFSASCPELCS 137
            ....:.|..::    |:||:|..::            ||      |..|:.|:..|..:.||.|.
  Fly    91 NGEGVPGQNQEIAGAGSLAVAMDSIISILHRRLKQDGCR------VVALQDGFNNFRQAFPEWCE 149

Human   138 KQSTP----------------MGL-SLPLSTSVPDSA------ESGCSSCSTPLYDQG------G 173
            ..:..                ||| ||.:||:..|||      .|.|.|.|...:...      .
  Fly   150 DDNQTHSKEIESSRNVQTDQLMGLRSLRISTTQSDSACSSSAESSDCESSSHHHHHHSHHNYNEA 214

Human   174 PVEILP-FLYLGSAYHASRKDMLDALGITALINVSANCPNHFE--GHYQYKSIPVEDNHKADISS 235
            ||||:| .|:||:|.|:...:.|....|..::||:.:.||.|:  |..:|..||:.|::..|::.
  Fly   215 PVEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAI 279

Human   236 WFNEAIDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS 300
            .|.:||.||:..::|...|.|||.||:|||.|:.|||||.|..:.|::||..|:.|:..:||||.
  Fly   280 HFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFH 344

Human   301 FMGQLLQFESQV------------LAPHC--------------SAEAGSPAMAV-LDRGTSTTT- 337
            ||.|||.||||:            :||.|              :|...||...: .||.|.:.| 
  Fly   345 FMQQLLSFESQLRLRPGSRFSCSCIAPDCNCMQTTGFMATHLANATGVSPDSGIEFDRWTPSDTG 409

Human   338 ---------VFNFPVSIPVHSTNSALSYL----------QSPITTSPS 366
                     .|..|.|..|....:|.|.|          .||.:|:.|
  Fly   410 LKXEQSGGKSFVLPPSQEVPFAAAATSPLPMCLAVNPDNMSPASTTSS 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP1NP_004408.1 DSP_MapKP 7..136 CDD:238723 35/127 (28%)
DSP_DUSP1 174..324 CDD:350486 67/178 (38%)
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723 35/127 (28%)
DSPc 215..353 CDD:238073 59/137 (43%)
CDC14 <242..359 CDD:225297 52/116 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.