DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP1 and CG7378

DIOPT Version :10

Sequence 1:NP_004408.1 Gene:DUSP1 / 1843 HGNCID:3064 Length:367 Species:Homo sapiens
Sequence 2:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster


Alignment Length:196 Identity:63/196 - (32%)
Similarity:93/196 - (47%) Gaps:22/196 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   137 SKQSTPMGLSLPLSTSV-PDSAESGCSSCSTPLYDQGGPVEILPFLYLGSAYHASRKDMLDALGI 200
            |:|:|...|...|..|: |..|..|.......::|.... |:.|.:|:|.|..|..|..|..:||
  Fly    34 SEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVDCD-EVYPGIYIGDAAAAKNKTYLRLMGI 97

Human   201 TALINVSANC---------------PNHFEGH----YQYKSIPVEDNHKADISSWFNEAIDFIDS 246
            |.::|.:..|               |:....|    ::|...|:.|....|||.:|..|..||||
  Fly    98 THVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDS 162

Human   247 IKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQ 311
            ..::||::.|||..|:|||||..|||||...::...:|...|:.||. |.||..|:.||...:.:
  Fly   163 AISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRD-IRPNDGFLQQLADLDME 226

Human   312 V 312
            :
  Fly   227 L 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP1NP_004408.1 DSP_MapKP 7..136 CDD:238723
DSP_DUSP1 174..324 CDD:350486 53/158 (34%)
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 53/157 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.