DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Otp and otp

DIOPT Version :9

Sequence 1:NP_035151.1 Gene:Otp / 18420 MGIID:99835 Length:325 Species:Mus musculus
Sequence 2:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster


Alignment Length:373 Identity:142/373 - (38%)
Similarity:165/373 - (44%) Gaps:121/373 - (32%)


- Green bases have known domain annotations that are detailed below.


Mouse    34 GGSDPGGHP-----------GDLAPNSDPVEGATLLPGEDITTVGSTPASLAVSAKDPDKQPGPQ 87
            ||...||.|           |.|..||:.:.|..   |......|:                ...
  Fly    50 GGGSSGGVPVGGGVARLHISGGLCDNSNALNGGN---GSSGNGNGN----------------NNN 95

Mouse    88 GGPNPSQAGQQQGQ----QKQKRHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRV 148
            |..|.:.:.|||.|    .|||||||||||||||||||.|:||||||||||||:|:|||||||||
  Fly    96 GNGNNNNSMQQQDQHLDKNKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRV 160

Mouse   149 QVWFQNRRAKWKKRKKTTNVFRAPGTLLPTPGLPQFPSAAAAAAAAMGDSLC--SFHANDTRWAA 211
            ||||||||||||||||||||||.||.|||:.|||  |..|.....||||.||  .....| ||:.
  Fly   161 QVWFQNRRAKWKKRKKTTNVFRTPGALLPSHGLP--PFGANITNIAMGDGLCGTGMFGGD-RWSV 222

Mouse   212 AAMP---GVSQL----PLPPAL----------------GRQQ-----AMAQS------------- 235
            ...|   |..||    ||..:|                |..|     |:..|             
  Fly   223 GVNPMTAGFGQLNQSSPLSSSLNSGLNSGINMGSALGAGSYQHYGLNALGDSMMYQHSVGGVSCG 287

Mouse   236 ------------LSQCSLAAGPPPNSMGLSNSLAGSNGAGL----------------QSHLYQPA 272
                        ::.|| :..|||.|...::|....||..:                |:|.:.|.
  Fly   288 PSGSPSATTPPNMNSCS-SVTPPPLSAQPNSSQNELNGEPMPLHQQQQQQTHQHQQQQTHQHHPM 351

Mouse   273 FPGMVPASLPGPSNVSGS-PQLCSSPDSSDVWRGT--SIASLRRKALE 317
            .|       |.|:..... ||...||  ||....|  |||:|||:|.|
  Fly   352 AP-------PTPTQQQQQLPQSMQSP--SDGANDTLHSIAALRRRASE 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OtpNP_035151.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..112 26/92 (28%)
Homeobox 107..156 CDD:395001 44/48 (92%)
OAR 303..320 CDD:397759 9/17 (53%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319 9/14 (64%)
otpNP_001286654.1 Homeobox 119..167 CDD:278475 43/47 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5965
eggNOG 1 0.900 - - E33208_3BA7E
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007109
OrthoInspector 1 1.000 - - oto95379
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46770
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4709
SonicParanoid 1 1.000 - - X5198
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.900

Return to query results.
Submit another query.