DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hlh-16 and CG33557

DIOPT Version :9

Sequence 1:NP_492372.2 Gene:hlh-16 / 183973 WormBaseID:WBGene00001960 Length:146 Species:Caenorhabditis elegans
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:94 Identity:30/94 - (31%)
Similarity:49/94 - (52%) Gaps:5/94 - (5%)


- Green bases have known domain annotations that are detailed below.


 Worm     3 SESPPGAEEEFEPYVRRKRSEAGGRKKMQGLNEQEQNLLRNSINSRERRRMHELNDEFETLRECL 67
            |.|..||..:.|.....:.:..||::. ||.:.:...  |..||:|||.|...:|..:|.||..:
  Fly    27 SASGSGAAADSEDSQIGQEANPGGQEN-QGNHRRRPP--RQKINARERYRTFNVNSAYEALRNLI 88

 Worm    68 PYPNEANSRRMSKANTLLLASNWIKQLAN 96
              |.|..:|::||...:.|||::|..|::
  Fly    89 --PTEPMNRKLSKIEIIRLASSYITHLSS 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hlh-16NP_492372.2 bHLH_TS 42..96 CDD:381396 21/53 (40%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I4152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000894
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.