DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clec-86 and lectin-22C

DIOPT Version :9

Sequence 1:NP_509202.1 Gene:clec-86 / 183775 WormBaseID:WBGene00016912 Length:166 Species:Caenorhabditis elegans
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:98 Identity:24/98 - (24%)
Similarity:39/98 - (39%) Gaps:10/98 - (10%)


- Green bases have known domain annotations that are detailed below.


 Worm    50 KTVGGSLVSIHSMIENNWIQKLAVDNLDADYDLFWIGGSDEGHTNDW-RWTDGSVLNFTNPGPGQ 113
            :.:||.|..|....:...|:.    ||..|.. :|:|.:|..|...: ....|....|.....|:
  Fly   165 RNMGGHLADIKDEADLAAIKA----NLKEDTH-YWLGINDLDHEGKFLSMPTGKQTTFLKWASGR 224

 Worm   114 P--LEDRHCGAMQLSTGRWFSDLCTVKHQFLCQ 144
            |  |:..:|  :.|..|..:...|....:|:||
  Fly   225 PSQLDTLNC--VFLYNGEMYDYPCHYTFRFICQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
clec-86NP_509202.1 CLECT 20..144 CDD:214480 22/96 (23%)
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 22/96 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.