DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chil-11 and Cht10

DIOPT Version :9

Sequence 1:NP_500856.2 Gene:chil-11 / 183470 WormBaseID:WBGene00016665 Length:389 Species:Caenorhabditis elegans
Sequence 2:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster


Alignment Length:368 Identity:88/368 - (23%)
Similarity:157/368 - (42%) Gaps:68/368 - (18%)


- Green bases have known domain annotations that are detailed below.


 Worm    35 THAVFG-------SLRVQLNGTF-EIGNAFSKRKFKNWQRAVKNSSSNVKSMISIGRW-DSV-TQ 89
            ||.::|       :|.:|.:.:: ::.|.|       ::|.|.......|..::||.| ||. .:
  Fly  1439 THIIYGFAVLSRDNLTIQPHDSWADLDNKF-------YERIVAYRKKGAKVTVAIGGWNDSAGDK 1496

 Worm    90 LSSVLLNVKSRRMFIESIVDFLKEHQLDGIDLFWRWVPLAVQSE-----------FCLFLEEVKI 143
            .|.::.|.::|..||.:::||::|:..||:||.|.: |:..|.:           |...:.|:..
  Fly  1497 YSRLVRNPEARSRFIRNVLDFIEEYNFDGLDLDWEY-PVCWQVDCKKGTAEEKIGFSALVRELFY 1560

 Worm   144 EFLNQEKQYILSITAPPVGIENYEDGYDIEEIIERVDFVNVYSMNYAAPWSNQWGTPTGPSAPLY 208
            .|  |.:..|||....| ..:..:.||::.|:.....:::|.:.:|    ..||...||..||:|
  Fly  1561 AF--QPRGLILSAAVSP-NKKVIDAGYEVAELSHYFSWISVMAYDY----HGQWDKKTGHVAPMY 1618

 Worm   209 GGLDARRKFSVDYTMKYYIRYTRKPEKFNLIIPFYVRHWRNVENAIKPGIEVFRNVTLQNNGAIG 273
            ...:....|:.:::|.|:|.......|..:.||.|.:.:...|.. |..:    |......|..|
  Fly  1619 SHPEGTANFNANFSMNYWISMGADRRKLVMGIPLYGQSFSLAETT-KHQL----NAPTYGGGEAG 1678

 Worm   274 EVYMSRWTAESDG--------IELSNPSWD---DTTKTLYIWKPETKTFITFETEKSIEAKANYV 327
            |...:|      |        :::.:..|:   ||...:..:......:::|:....|..|:.|:
  Fly  1679 EATRAR------GFLAYYEICLKIRHHRWNVVRDTKGRIGPFAYHGDQWVSFDDVPMIRHKSEYI 1737

 Worm   328 KSMNLGGVWIWLMENDDQDN----------SMIEAVSGQFGNP 360
            |:|.|||..||.::.||..|          ..|..|...||.|
  Fly  1738 KAMGLGGAMIWALDLDDFKNVCECESYPLLKAINRVLRGFGGP 1780

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chil-11NP_500856.2 Glyco_18 13..343 CDD:214753 80/339 (24%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753 80/339 (24%)
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351 84/360 (23%)
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164211
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.