powered by:
Protein Alignment hlh-15 and Fer1
DIOPT Version :9
Sequence 1: | NP_508440.1 |
Gene: | hlh-15 / 183427 |
WormBaseID: | WBGene00001959 |
Length: | 89 |
Species: | Caenorhabditis elegans |
Sequence 2: | NP_001262334.1 |
Gene: | Fer1 / 2768661 |
FlyBaseID: | FBgn0037475 |
Length: | 256 |
Species: | Drosophila melanogaster |
Alignment Length: | 74 |
Identity: | 30/74 - (40%) |
Similarity: | 45/74 - (60%) |
Gaps: | 0/74 - (0%) |
- Green bases have known domain annotations that are detailed below.
Worm 16 RKLSKAERRKRRRATPKYRNLHATRERIRVESFNMAFSQLRALLPTLPVEKKLSKIEILRFSIAY 80
|:..|..|.|......:.|.....|||.|::|.|.||..||..:||||.||:|||::.|:.:|:|
Fly 70 RRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISY 134
Worm 81 ISFLDNLLQ 89
|:||..:::
Fly 135 ITFLSEMVK 143
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.