DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hlh-15 and Fer1

DIOPT Version :9

Sequence 1:NP_508440.1 Gene:hlh-15 / 183427 WormBaseID:WBGene00001959 Length:89 Species:Caenorhabditis elegans
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:74 Identity:30/74 - (40%)
Similarity:45/74 - (60%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


 Worm    16 RKLSKAERRKRRRATPKYRNLHATRERIRVESFNMAFSQLRALLPTLPVEKKLSKIEILRFSIAY 80
            |:..|..|.|......:.|.....|||.|::|.|.||..||..:||||.||:|||::.|:.:|:|
  Fly    70 RRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISY 134

 Worm    81 ISFLDNLLQ 89
            |:||..:::
  Fly   135 ITFLSEMVK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hlh-15NP_508440.1 bHLH_TS_HEN 32..88 CDD:381420 26/55 (47%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.