DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSC22D3 and bun

DIOPT Version :9

Sequence 1:NP_001305397.1 Gene:TSC22D3 / 1831 HGNCID:3051 Length:200 Species:Homo sapiens
Sequence 2:NP_001036357.2 Gene:bun / 34665 FlyBaseID:FBgn0259176 Length:1331 Species:Drosophila melanogaster


Alignment Length:171 Identity:69/171 - (40%)
Similarity:89/171 - (52%) Gaps:10/171 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    33 SSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDS-LE--PVLRDPCYLINEGICNRNI 94
            |.|....||.|..|:.........|:.|.....:...|..| ||  .|..........|......
  Fly  1088 SFGSAAMPGHPAASSRISFSYDPAFQRLQVPNASGDRRPRSPLECASVFAAVAAAATCGDAAGGA 1152

Human    95 DQTMLSILLFFHSASGASVVAIDNKIEQAMDLVKNHLMYAVREEVEILKEQIRELVEKNSQLERE 159
            ..|::|      ||||.|.|||||||||||||||:|||.|||||||:|||:|.||::|.::||.|
  Fly  1153 ADTVIS------SASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKLELE 1211

Human   160 NTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV 200
            |::||:....|.|::.|..|....| |.:|.:..||...:|
  Fly  1212 NSILKSNIPQETLQQLQLQLQLAAP-PATPAIQAAPAVQSV 1251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSC22D3NP_001305397.1 TSC22 124..180 CDD:307358 31/55 (56%)
bunNP_001036357.2 TSC22 1176..1223 CDD:279505 28/46 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154585
Domainoid 1 1.000 70 1.000 Domainoid score I9543
eggNOG 1 0.900 - - E1_KOG4797
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001302
OrthoInspector 1 1.000 - - otm42281
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2903
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.