DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clec-202 and lectin-22C

DIOPT Version :9

Sequence 1:NP_503095.2 Gene:clec-202 / 183067 WormBaseID:WBGene00007822 Length:476 Species:Caenorhabditis elegans
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:264 Identity:47/264 - (17%)
Similarity:92/264 - (34%) Gaps:69/264 - (26%)


- Green bases have known domain annotations that are detailed below.


 Worm     8 FCAVVIMPNL--------LAMSDEETRGRQAMVANFVKDNQKTIRNGKGDKWMSNFLKTQNLTFH 64
            ||..|:.|.|        ||.|:..::..:.:|..:..:.|.|.            |:.:.|:..
  Fly    40 FCLGVLTPVLNHLTISQNLANSNNSSKANEVLVRQYTMEGQLTA------------LQNKQLSIE 92

 Worm    65 RSLSSPSAMSDSSSQNLVVLADVGTAACASG-----------------WTRYDLTGMCYQQSKKT 112
            .:|.:.....:.:.||.....:     |..|                 :..::..|..|...:|.
  Fly    93 VALDAQGRKLNVNEQNFTERLN-----CMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKV 152

 Worm   113 --MNWYQGEDYCWNLRPGAHSASVHSQEEAKWLNSLYRDKKNGGQMDSWIGLRRDCDNVTYIWT- 174
              .||......|.|:  |.|.|.:..:.:...:.:..::..:     .|:|: .|.|:.....: 
  Fly   153 SEKNWSTASKTCRNM--GGHLADIKDEADLAAIKANLKEDTH-----YWLGI-NDLDHEGKFLSM 209

 Worm   175 -DGSPTDCLWWQPDYPKSEFAEFSCVTIWETDWLYDNPAYIPGQYDDMKECSDDGSNVICKYDPN 238
             .|..|..|.|....| |:....:||.::..: :||.|.:...::             ||:.:..
  Fly   210 PTGKQTTFLKWASGRP-SQLDTLNCVFLYNGE-MYDYPCHYTFRF-------------ICQTEEE 259

 Worm   239 TLNI 242
            .||:
  Fly   260 DLNV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
clec-202NP_503095.2 CLECT 92..210 CDD:214480 25/138 (18%)
CLECT 360..472 CDD:382969
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 25/131 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.