DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AGT and Spn42Dd

DIOPT Version :9

Sequence 1:NP_001369746.2 Gene:AGT / 183 HGNCID:333 Length:476 Species:Homo sapiens
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:373 Identity:89/373 - (23%)
Similarity:165/373 - (44%) Gaps:59/373 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   124 VLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLV--AQG 186
            |:||.::...|:.:::||...||..||:.||:|.:||            .|:.|..|.|:  .||
  Fly    35 VVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDK------------EAVAARYGALLNDLQG 87

Human   187 RADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVL-PRSLDFTELDVAAEKIDRFMQAVT 250
            :.:..   :|.....::......|.|.:  .||:..|... ..|:..|...||||:|::::...|
  Fly    88 QEEGP---ILKLANRIYVNDQYSLNQNY--NLAVREPFKSEAESISLTNGPVAAERINQWVLDQT 147

Human   251 GWKTGCSL----MGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQ 311
            ..|....:    |.:.|.:.|....|...|.:.|..........|.|..:.||.|.|::.||||:
  Fly   148 SGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFR 212

Human   312 --HWSDIQDNFSVTQVPFTES-ACLLLIQPHYASDLDKVEGLT-FQQNSLNWMKKLSPRTIHLTM 372
              ::.|:  :..|.::|:..| ..:.:..|.      :||||: .::..:.:.:.|..:.::|.:
  Fly   213 ANYFRDL--DAQVIELPYLNSNLSMTIFLPR------EVEGLSALEEKIVGFARPLVAKEVYLKL 269

Human   373 PQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRI--RVGEVLNSIFFELEADEREPTESTQ 435
            |:..::...:|::.|.:..:..:...:.:|..|..|:.  :|.:|.:..|.|:..:..|...:|.
  Fly   270 PKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATS 334

Human   436 QLNKPEVLEVTLNR-----------PFLFAVYDQSATALHFLGRVANP 472
                   :.|| ||           ||.|.:.|  |..::|.|||.:|
  Fly   335 -------VAVT-NRAGFSTFLMADHPFAFVIRD--ANTIYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AGTNP_001369746.2 serpinA8_AGT 28..474 CDD:381010 89/373 (24%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 86/368 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.