Sequence 1: | NP_502375.4 | Gene: | clec-185 / 182914 | WormBaseID: | WBGene00007729 | Length: | 504 | Species: | Caenorhabditis elegans |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001137766.1 | Gene: | lectin-22C / 7354375 | FlyBaseID: | FBgn0259230 | Length: | 263 | Species: | Drosophila melanogaster |
Alignment Length: | 203 | Identity: | 44/203 - (21%) |
---|---|---|---|
Similarity: | 75/203 - (36%) | Gaps: | 51/203 - (25%) |
- Green bases have known domain annotations that are detailed below.
Worm 35 LENKTLSDVIELNQ-----HVQRARYLERLENEKGKLSDEGQQNLVLADGAVLPCDATWHQYSG- 93
Worm 94 --TGCCYRTTDEKSE--WYGGTELCR-------ALHPQAQLASFHSQGESEFVCKKYSSIHAWTG 147
Worm 148 LSQTETPGVW-TYTDG--TPDWHWFFAQSSTMTTEKSCVEMMDGVLVLLFSWSAKKGQTQPYSCT 209
Worm 210 ESIASICK 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
clec-185 | NP_502375.4 | CLECT | 84..217 | CDD:214480 | 28/147 (19%) |
CLECT | 391..500 | CDD:214480 | |||
lectin-22C | NP_001137766.1 | CLECT | 146..255 | CDD:153057 | 24/130 (18%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |