DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hlh-14 and Fer1

DIOPT Version :9

Sequence 1:NP_495131.3 Gene:hlh-14 / 182758 WormBaseID:WBGene00001958 Length:148 Species:Caenorhabditis elegans
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:145 Identity:35/145 - (24%)
Similarity:66/145 - (45%) Gaps:18/145 - (12%)


- Green bases have known domain annotations that are detailed below.


 Worm     1 MAKKNQVARNERERKRVHQVNHGFDVLRNRLQPKNHTKKWSKADTLREAVKYIQQLQVLLNQD-- 63
            ||::.|.| |.|||:|:..:|..|:.||..:....:.|:.||.|||:.|:.||..|..::.:|  
  Fly    84 MAQQRQAA-NLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKN 147

 Worm    64 ------------PQQPSVSSSTPDYTMNNSNNFNNYAVKEEF--SMYLPQNYCPQNQMSVPHGDV 114
                        .::|.......|.|...:::.:.|...:.:  |....:.:.|::... ||...
  Fly   148 GNEPGLSLQRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPRG-PHSQP 211

 Worm   115 SHNFNSPTSSVSSSS 129
            ...:|:..|:.:.:|
  Fly   212 LPLYNNSNSNQNQNS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hlh-14NP_495131.3 bHLH_SF 9..60 CDD:381792 19/50 (38%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.