DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAM and DIP-delta

DIOPT Version :9

Sequence 1:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:425 Identity:102/425 - (24%)
Similarity:156/425 - (36%) Gaps:67/425 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   585 TSQSVHVTVKVPPFIQPFEFPRFSIGQRVFIPCVV------------VSGDLPITITWQKDGRPI 637
            |:...||.:..|.|.||......::|:...:||||            :...:.:||......| |
  Fly    33 TNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISR-I 96

Human   638 PGSLGVTIDNIDFTSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQLIVRVPPKFV--------V 694
            |   ..:|...|.|..|.::.......|.|.|.. |....:.....|.|.|||..:        |
  Fly    97 P---RYSITYTDNTWLLHVNQAHQDDRGYYMCQV-NTNPMISQVGYLQVVVPPNILDIESTPSSV 157

Human   695 QPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSNGS--LLIKHVV 757
            ..|:...|.     :.|.|:|:|.|.|:|:...|      :.||:..:.:||...:  |.:..|.
  Fly   158 AVRENQNIN-----MTCRADGFPAPKIIWRREDG------EEIAVEKKKKVLVYDADVLPLTKVS 211

Human   758 EEDSGYYLCKVSNDVGADVSKSMYLTVKIPAMITSYPNTTL-ATQGQKKEMSCTAHGEKPIIVRW 821
            ..:.|.|||..:|.|...|||.:.|.|:...||. .||..: |..|....:.|........|:.|
  Fly   212 RNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIW-VPNQLVGAPSGTDVTIDCHTEAHPKAIIYW 275

Human   822 EKEDRIINPEMARYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPP 886
            .....::.|. .:|.....|........|.|......|.|.:.|.:.||.||..|.|::.....|
  Fly   276 VYNSVMVLPS-KKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLP 339

Human   887 DPPEIEIKDVKARTITLRWTMGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIH 951
            ..|.   |.|...|:..|     :.|       |...:::|:      ||.:...:..|...|::
  Fly   340 STPS---KQVTHTTVESR-----ENN-------IIPSSRNDT------TKSLQTDVGYAMKNDLY 383

Human   952 PSSTYSIRMYAKNRIGKSEPSNELTITADEAAPDG 986
            |.|..|     .:..|.|..::..:.....|.|.|
  Fly   384 PGSASS-----SSSGGSSSAASSSSSMQTSALPGG 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352
I-set 315..385 CDD:333254
Ig_3 407..488 CDD:316449
IGc2 518..575 CDD:197706
I-set 596..686 CDD:333254 23/101 (23%)
Ig_DSCAM 707..784 CDD:143211 24/78 (31%)
Ig 802..889 CDD:325142 19/86 (22%)
FN3 885..978 CDD:238020 18/92 (20%)
FN3 986..1083 CDD:238020 1/1 (100%)
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 20/96 (21%)
Ig 145..238 CDD:416386 28/103 (27%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 2/11 (18%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 1/7 (14%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 4/6 (67%)
Ig strand G 230..238 CDD:409353 4/7 (57%)
Ig 242..333 CDD:416386 23/92 (25%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 1/6 (17%)
Ig strand C 272..277 CDD:409353 2/4 (50%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 314..322 CDD:409353 2/7 (29%)
Ig strand G 325..334 CDD:409353 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.