DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAM and dpr15

DIOPT Version :9

Sequence 1:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens
Sequence 2:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster


Alignment Length:444 Identity:87/444 - (19%)
Similarity:139/444 - (31%) Gaps:146/444 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   204 TGETRQSNSARLFVSDPANSAPSILDGFDHRKAMAGQRVELPCKALGHPEPDYRWLK-------- 260
            |..|....:.|..|:......|..:|.:....:.||....|||......:....||:        
  Fly   169 TPTTTTRRTTRRPVATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILT 233

Human   261 -DNMPLELSGRFQKTVT------GLLIENIRPSDSGSYVCEVSNRYGTAKVIGRLYVKQPLKATI 318
             |........|||...:      .|.|:.::..|.|:|.|:||.. ..|..|..|.:.:|....|
  Fly   234 VDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTE-PKASAIVHLRIVEPKTELI 297

Human   319 --SPRKVKSSVGSQVSLSCSVTGTEDQEL--SWYRN----------------------------- 350
              |.|.||:  ||||.|.|.::...:..|  :|:.|                             
  Fly   298 GESTRHVKA--GSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTS 360

Human   351 -------------------------------------GEILNPGKNVRITGINHENLIMDHMVKS 378
                                                 .|.||  ..|.||    .:.|:|.:.::
  Fly   361 TTTTTTTTTASTTTTTTSTTPATPSTTATGSTEGATSSETLN--GLVTIT----RSYILDAISQN 419

Human   379 D----GGAYQCFVRKDKLSAQDYVQVV-------LEDGTPKIISAFSEKVVSPAEPVSLMC--NV 430
            |    |.|....|..:..:||...:|.       ...|...:.|..:......|..::...  :.
  Fly   420 DVSELGAAAGVAVATETSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDS 484

Human   431 KGTPLPTITW--TLDDDPILKGGSHRISQMITSEGNVVSYLNISSSQVR---------------D 478
            ..|...|..|  |:|            ::..|:.....:.:..|||.::               |
  Fly   485 AATAATTSAWLTTMD------------AEAATTAATTTTTMLPSSSFIKQITTASLIIPAVVKLD 537

Human   479 GGVYRCTANNSA--GVVLYQARINVRGPASIRPMK----NITAIAGRDTYIHCR 526
            .|.|.|:.:|||  .:||:.    :.|..|...:|    :.:|:.|...|:|.|
  Fly   538 SGNYTCSPSNSAPRTIVLHV----LNGEYSASAIKSGSVSWSALIGCHGYLHWR 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352 22/89 (25%)
I-set 315..385 CDD:333254 25/143 (17%)
Ig_3 407..488 CDD:316449 15/99 (15%)
IGc2 518..575 CDD:197706 4/9 (44%)
I-set 596..686 CDD:333254
Ig_DSCAM 707..784 CDD:143211
Ig 802..889 CDD:325142
FN3 885..978 CDD:238020
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 22/92 (24%)
V-set 204..290 CDD:284989 21/86 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.