DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAM and CG7166

DIOPT Version :9

Sequence 1:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:455 Identity:103/455 - (22%)
Similarity:172/455 - (37%) Gaps:95/455 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   596 PPFIQPFEFPRFSIGQRVFIPCVVVS-GDLPITITWQKDGRPI-PGSLGVTID---NIDFTSSLR 655
            |.|:......:..:|:.:.:||.|.: |.  ..:.|:|....: .|.|.:|.|   .|....:|:
  Fly    39 PKFLSRGHLYKVIVGETIELPCKVQNLGS--FVLLWRKGSSVLTAGHLKITRDQRFKIVGDYNLQ 101

Human   656 ISNLSLMHNGNYTCIA-----RNEAAAVEHQSQLIVRVPPKFVVQPRDQD--GIYGKAVILNCSA 713
            |:.:.....|:|.|..     |::...||      :.|||.....|.:..  ...|..|.|.|.|
  Fly   102 INGVKTQDAGDYICQLGDQENRDQVHTVE------ILVPPTLRALPHNGQVTARKGSTVTLECKA 160

Human   714 EGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGADVSK 778
            .|.|||||.|          |:....:|...:..:.:|::::|....:|.|.|...|.|...||.
  Fly   161 SGNPVPTIFW----------FKKDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADNGVKDRVSM 215

Human   779 SMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRWEKEDRIINPEMARYLVSTKEVG 843
            .:.||:..|..||...:...|::|...|:.|..||:....:.|.:...:::....|.:....:..
  Fly   216 DIQLTILSPPEITVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRY 280

Human   844 EEVISTLQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPD--------------------- 887
            ..:|...|  ||   |.|.:||.|.|:.|..:..|:::.:..|.                     
  Fly   281 SLIIRNFQ--PT---DFGNYSCVADNALGRTKKYIEVSGRPGPADFISPALSGFLDHYNLTWTIE 340

Human   888 --PPEIEIKDVKARTITLRWTMGFDGN--------SPITGYDIECKNKSDSWDSAQRTKDVSPQL 942
              ||..||| :..|.:.:..|....|.        :||                  || |.|..|
  Fly   341 SIPPLDEIK-LLYRRLLMNETYQHPGKWHEYHIKPTPI------------------RT-DGSHFL 385

Human   943 NSATIIDIHPSSTYSIRMYAKNRIGKSEPS---------NELTITADEAAPDGPPQEVHLEPISS 998
            .|..:.::..::.|...:.|||:.|.:|.|         ::|.:..|.....|....:.:.|..|
  Fly   386 MSYLVKNLEHNAVYEAIVQAKNKYGWNEISDIHQFYTRNHDLLLDIDMEYKMGISSNIRISPTVS 450

Human   999  998
              Fly   451  450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352
I-set 315..385 CDD:333254
Ig_3 407..488 CDD:316449
IGc2 518..575 CDD:197706
I-set 596..686 CDD:333254 22/99 (22%)
Ig_DSCAM 707..784 CDD:143211 23/76 (30%)
Ig 802..889 CDD:325142 20/109 (18%)
FN3 885..978 CDD:238020 25/132 (19%)
FN3 986..1083 CDD:238020 3/13 (23%)
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 20/90 (22%)
Ig 56..116 CDD:143165 15/61 (25%)
IG_like 144..221 CDD:214653 24/86 (28%)
IGc2 151..209 CDD:197706 20/67 (30%)
IG_like 232..313 CDD:214653 20/85 (24%)
Ig 242..311 CDD:143165 17/73 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.