DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAM and dpr10

DIOPT Version :9

Sequence 1:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:237 Identity:49/237 - (20%)
Similarity:88/237 - (37%) Gaps:73/237 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   511 KNITAIAGRDTYIHCRVIGYPYYSIKWYKNSNLLPFN----------------HRQVAFENNGTL 559
            :|||::.|:..|:.|||......::.|.::.:|....                ||.:   :..||
  Fly    61 RNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDI---DEWTL 122

Human   560 KLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVT----VKVPPFIQPF------------------ 602
            ::...|:. |.|.|.|.:..||..|.|.::::.    .:....:|.:                  
  Fly   123 QIKWAQQR-DAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSN 186

Human   603 -EF------------PRFSI----------GQRVFIPCVV-VSGDLPITITWQKDGRPIP----- 638
             ||            |..:|          |..:.:.|:: .|.:.|..|.|....:.:.     
  Fly   187 DEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSG 251

Human   639 GSLGV-TIDNIDFTSSLRISNLSLMHNGNYTCIARN-EAAAV 678
            |.|.. ||.:.:..|.|.|.:..|:|:|.|:|...| |.|::
  Fly   252 GRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352
I-set 315..385 CDD:333254
Ig_3 407..488 CDD:316449
IGc2 518..575 CDD:197706 15/72 (21%)
I-set 596..686 CDD:333254 26/132 (20%)
Ig_DSCAM 707..784 CDD:143211
Ig 802..889 CDD:325142
FN3 885..978 CDD:238020
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
dpr10NP_729591.1 Ig 63..143 CDD:299845 18/83 (22%)
IG_like 210..297 CDD:214653 21/84 (25%)
IGc2 217..287 CDD:197706 18/69 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.