DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAM and Dscam2

DIOPT Version :10

Sequence 1:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:1991 Identity:631/1991 - (31%)
Similarity:982/1991 - (49%) Gaps:169/1991 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     1 MWI----LALSLFQSFANVFSEDLHSSLY---FVNASLQEVVFASTTGTLVPCPAAGIPPVTLRW 58
            |||    ..:.|..:..|..||...:.|.   ||......|.|::::|..:.|.|:|.|..|:.|
  Fly     1 MWISSRFFVILLLLNLDNTCSEPFEAHLRGPGFVMEPPGRVEFSNSSGGWLDCSASGSPQPTVDW 65

Human    59 YLATGEEIYDVPGIRHVHPNGTLQIFPFPPSSFSTLIHDNTYYCTAENPSGKIRSQDVHIKAVLR 123
            ..|.|..:.::.|:|.|..||||.:.||..:::...:|:..|.|.|.|..|:|.|:||.::||:.
  Fly    66 VHADGSAVTEIHGVRRVLRNGTLVLMPFAAAAYHQDVHNTIYRCIASNSVGRIVSRDVQVRAVVA 130

Human   124 EPYTVRVEDQKTMRGNVAVFKCIIPSSVEAYITVVSWEKDTV-----SLVSGSRFLITSTGALYI 183
            :.|.|.||.....||..|:.:|::|:.|:..:.||||..:..     ||....:|.:..||.|.|
  Fly   131 QAYKVDVEVLSAARGCTAILRCVVPTFVKELVRVVSWVHEPAIYIYPSLQGDGKFHLLPTGELLI 195

Human   184 KDVQNEDGLYNYRCITRHRYTGETRQSNSARLFVSDPANS-----APSILDGFDHRKAMAGQRVE 243
            .::|..|...::||.:.||.|.:...|:..||.:    ||     :||:::...|.:....:...
  Fly   196 HNLQESDESQSFRCRSMHRLTRQVVVSSPTRLRI----NSHRGIISPSVVEHTAHVQVSQDEGAV 256

Human   244 LPCKALGHPEPDYRWLKDN----MPLELSG-RFQKTVTGLLIENIRPSDSGSYVCEVSNRYGTAK 303
            |.|.|.|.|.|:|.|...|    :|: ||| |.:.....|.||.:...|||.|.|...|..|.|.
  Fly   257 LLCVAQGCPSPEYSWFTHNGAGPLPV-LSGPRVRLLGPILAIEAVTGEDSGVYKCTAGNVGGEAS 320

Human   304 VIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGTED----QELSWYRNGEILNPGKNVRITG 364
            ...||.|..|::..|||..:...:|......|.||....    |.:.||::      |:.:..:|
  Fly   321 AELRLTVATPIQVEISPNVLSVHMGGTAEFRCLVTSNGSPVGMQNILWYKD------GRQLPSSG 379

Human   365 INHENLIMDHMVKSDGGAYQCFVRK---DKLSAQDYVQVVLEDGTPKIISAFSEKVVSPAEPVSL 426
            ...:.|::..:.:.:.|.|||.||:   |...|...:|  |.|..|.::.:|.|:.:.|...|||
  Fly   380 RVEDTLVVPRVSRENRGMYQCVVRRPEGDTFQATAELQ--LGDAPPVLLYSFIEQTLQPGPAVSL 442

Human   427 MCNVKGTPLPTITWTLDDDPILKGGSHRISQMITSEGNVVSYLNISSSQVRDGGVYRCTANNSAG 491
            .|:..|.|.|.|:||||..|:...|...|.|.||..|:|:|::|||...|.|||.|.|.|.|.||
  Fly   443 KCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVHGDVISHVNISHVMVEDGGEYACIAENRAG 507

Human   492 VVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNSNLLPFNHRQVAFENN 556
            .|.:.||:|:.|...||.:..:||::|....:.|.|.|||...|.|.:....||.:.|| ..:.:
  Fly   508 RVQHAARLNIYGLPYIRLIPKVTAVSGETLNLKCPVAGYPIEEIHWERGGRELPDDIRQ-RVQPD 571

Human   557 GTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFIQPFE--FPRFSIGQRVFIPCVV 619
            |:|.:|.|||..|.|.|||....:...|..:|..|||.|||.:.||:  ..:.::|.|..:.|.|
  Fly   572 GSLTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPKLSPFQTNILQLNMGDRASLTCSV 636

Human   620 VSGDLPITITWQKDGRPIPGSLGVTIDNID-FTSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQ 683
            |.||||:||.|:||||||..:..:::..:| :.|.|.|.||...|.|||:|:.||.||.||:...
  Fly   637 VKGDLPLTINWRKDGRPIDPTQHMSVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQA 701

Human   684 LIVRVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSN 748
            |:|.|||:::|:|.|.:....:.::|:|.|:|.|.|:||||.:.|:...:::.:......::|.|
  Fly   702 LLVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGN 766

Human   749 GSLLIKHVVEEDSGYYLCKVSNDVGADVSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHG 813
            ||||::||.|:..|:|||:.:|.:|..:.|.:.|.|......:|...:.:..:|....:.|...|
  Fly   767 GSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSG 831

Human   814 EKPIIVRWEKEDR-IINPEMARYLVSTKE--VGEEVISTLQILPTVREDSGFFSCHAINSYGEDR 875
            :|||.:.|.:..: .:||. ..|.:|.|:  ..:.|.:.|||......|||.:.|.|.|.||.|:
  Fly   832 DKPINIVWMRSGKNTLNPS-TNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQ 895

Human   876 GIIQLTVQEPPDPPEI-EIKDVKARTITLRWTMGFDGNSPITGYDIECKNKS---------DSWD 930
            .::||.|||||.||.: |...:.:|::.::|.....|...:|.|.:|.:...         |.|.
  Fly   896 QLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSLPPALFVDQWQ 960

Human   931 SAQRTKDVSPQLNSATIIDIHPSSTYSIRMYAKNRIGKSEPSNELTITADEAAPDGPPQEVHLEP 995
            ..: .|| .|..| |.|.::.|::.|:.|:.|:...|:|.||.||.:..:...|.|||..:...|
  Fly   961 QIE-VKD-PPHFN-AMIENLKPATRYAFRVIAEGSAGRSAPSQELIVRTEPQRPAGPPLSLSARP 1022

Human   996 ISSQSIRVTWKAPKKHLQNGIIRGYQIGYREYSTGGNFQFNIISVDTSGD--SEVYTLDNLNKFT 1058
            :||..:.::|.||...|::|.|:||.:||: .|:.||..:|..||...||  :....|..|.||.
  Fly  1023 LSSTELLISWVAPLPELRHGDIQGYNVGYK-LSSSGNTAYNFTSVSGDGDGGNGELLLSGLAKFA 1086

Human  1059 QYGLVVQACNRAGTGPSSQEIITTTLEDVPSYPPENVQAIATSPESISISWSTLSKEALNGILQG 1123
            :|.:||||.|:.|.||.|:.....|:|||||.|||:|:..|.|.:|:.:||........||:|||
  Fly  1087 RYTVVVQAFNQVGPGPLSEPTAAQTMEDVPSRPPEDVRCAALSSQSLQVSWQPPPIYHTNGLLQG 1151

Human  1124 FRVIYWANLMD--GELGEIKNITTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKE 1186
            :::|:...:.|  ....|:::..||..::.|.||.|||||||||||.||.||||.|:.:|..::|
  Fly  1152 YKLIFEPIIDDIQPSKDEVESRKTTALTMVLTGLRKYTNYSIQVLAHTRMGDGVVSKPLFCHSEE 1216

Human  1187 DVPGPPAGVKAAAASASMVFVSWLPPLKLNGIIRKYTVFCSHPYPTVI-------SEFEASPDSF 1244
            |||..||.:|..::|:..:::|||||.:.||:|.||::     |..|:       :|..:.|...
  Fly  1217 DVPEAPADIKVVSSSSQSLYISWLPPNEPNGVITKYSL-----YTRVVNGREELNNEKRSLPSQQ 1276

Human  1245 S-YRIPNLSRNRQYSVWVVAVTSAGRGNSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPCK 1308
            : |....|..:.:|..||.|.|..|.|.||.:.:.....:.||||::|.|.|..||...:.|||.
  Fly  1277 AYYEAKGLHPHMEYQFWVTASTRVGEGKSSRVSSQITTNRIPARIISFGGPVVRPWRSTVTLPCT 1341

Human  1309 AVGDPSPAVKWMKD-----SNGTPSLVTIDGRRSIFSNGSFIIRTVKAEDSGYYSCIANNNWGSD 1368
            |||.|..  :|.|.     ..|..:...:|       :|..||.:::..|.|.|||..:|..|:|
  Fly  1342 AVGKPKR--EWFKSDVALRQGGLHNSQLLD-------SGDLIISSLQLADGGNYSCQVDNGIGTD 1397

Human  1369 EIILNLQVQVPPDQPRLTVSKTTSSSITLSWLPGDNGGSSIRGYILQYSEDNSEQWGSFPISPSE 1433
            .:...|.|||||..|.|.|:..|||||.:.|..|..|.:.|.||.|.|...|... ....:|...
  Fly  1398 RLTHTLIVQVPPTAPVLYVTSATSSSILMHWKCGFTGNAPITGYTLFYRRANGNT-DEMQLSRHA 1461

Human  1434 RSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQELFASINTTRVRLNLIG 1498
            .|:.|:.|.||:.|:..|:|||.||....|.|:..:|.|:.|.......|.|. |:|.:.:.|..
  Fly  1462 SSHELKGLMCGSTYQIHLSAQNKVGTSPTSTILHVRTQGQSPGHPASTALLAP-NSTSLLVRLHS 1525

Human  1499 WNDGGCPITSFTLEYRPF---GTTVWT-TAQRTSLSKSYILYDLQEATWYELQMRVCNSAGCAEK 1559
            |.|.|||:..|.|:||..   ....|. .:......:..::.:||.:|.|:|:|...|.||.::.
  Fly  1526 WPDNGCPLLYFVLQYRAVTDDPDAEWVLVSNALKPQRRIVINNLQPSTLYQLRMEAHNVAGISQA 1590

Human  1560 QANFATLNYDGSTIPPLIKSVVQNEEGLTT--NEGLKMLVTISCILVGVLLLFVLLLVVRRRRRE 1622
            :.||.||..||...||.|  :.:...|.||  ...:.:|:.....:.|:....::::|..|.   
  Fly  1591 EFNFVTLTKDGDPPPPEI--MHRGRSGQTTVIFANINLLIPTIAAVSGMFCTIIMIIVCYRH--- 1650

Human  1623 QRLKRLRDAKSLAEM-LMSKNTRTSDTLSKQQQTLRMHIDIPRAQLLIEER--DTMETIDDRSTV 1684
                .|::|..|||. .:.|.:..:...|:..|..|.:..|.:..:...::  :|.|.|...:|.
  Fly  1651 ----MLKNAPPLAEQSQIQKESLENRANSEAAQRERYYATIHKVSMQNNDKIPETSEDISPYATF 1711

Human  1685 LLTDADFGEAAKQ----KSLTVTHTVHYQSVSQATGPLVDVSDARPGTNPTTRRNA-KAGPTARN 1744
            .|::|. |..::.    .:.|:.|:..|...:.|.|    .|...|..:...||:: |..|.:..
  Fly  1712 QLSEAG-GNMSQPHHGGPANTLLHSFMYHERALAEG----CSSPPPAASKNRRRHSRKTEPESEE 1771

Human  1745 RYASQWTLNRPHPTISAHTLTTDWRLPTPRAAGSVDKESDSYSVSPSQDTDRARSSMVSTESASS 1809
            ..:.|                              |:.:.|.:.|.:|...:.:.|::...:.||
  Fly  1772 SESDQ------------------------------DQLTSSRTESSNQHEGKIKHSIIYHGAQSS 1806

Human  1810 TYEELARAYEHAKM---------EEQLRHAKFTITECFISDTSSEQLTAGTNEYTDSLTSSTPSE 1865
            |..:|:...|...:         .:|.:.:..|......|:..:...|:.||. |.:.|::|||.
  Fly  1807 TSSDLSPMSEQKSLPRRGRSRYHHQQYQFSTNTTPRHHNSNKMNNNTTSNTNT-TATNTTATPST 1870

Human  1866 SGICRFTASPPKPQDGGRVMNMAVPKAHRPGDLIHLPPYLR 1906
            |.......||    .||.:.:::.....:.....|:|..::
  Fly  1871 SSNSNKILSP----RGGNLKSISSTFKSQDSIQCHIPTLVK 1907

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAMNP_001380.2 FN3 885..978 CDD:238020 29/102 (28%)
FN3 <937..1300 CDD:442628 142/374 (38%)
Ig_3 1287..1363 CDD:464046 26/80 (33%)
FN3 1380..1470 CDD:238020 33/89 (37%)
FN3 1486..1555 CDD:238020 20/72 (28%)
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012 58/307 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810 13/92 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883 9/27 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
Ig 26..121 CDD:472250 32/94 (34%)
Ig strand B 42..46 CDD:409353 0/3 (0%)
Ig strand C 55..59 CDD:409353 1/3 (33%)
Ig strand E 79..83 CDD:409353 3/3 (100%)
Ig strand F 99..104 CDD:409353 2/4 (50%)
Ig strand G 112..116 CDD:409353 1/3 (33%)
Ig 125..210 CDD:472250 28/89 (31%)
Ig strand B 141..145 CDD:409353 1/3 (33%)
Ig strand C 157..161 CDD:409353 3/3 (100%)
Ig strand E 179..183 CDD:409353 2/3 (67%)
Ig strand F 192..199 CDD:409353 2/6 (33%)
I-set 235..310 CDD:400151 27/79 (34%)
Ig strand B 242..246 CDD:409353 1/3 (33%)
Ig strand C 255..259 CDD:409353 1/3 (33%)
Ig strand F 290..295 CDD:409353 2/4 (50%)
Ig 313..395 CDD:472250 21/88 (24%)
Ig strand B 331..335 CDD:409353 0/3 (0%)
Ig strand C 344..348 CDD:409353 0/3 (0%)
Ig strand E 368..372 CDD:409353 1/3 (33%)
Ig strand F 382..387 CDD:409353 3/4 (75%)
Ig 406..501 CDD:472250 41/94 (44%)
Ig strand B 424..428 CDD:409353 3/3 (100%)
Ig strand C 437..441 CDD:409353 1/3 (33%)
Ig strand E 467..471 CDD:409353 1/3 (33%)
Ig strand F 481..486 CDD:409353 2/4 (50%)
Ig strand G 494..497 CDD:409353 0/2 (0%)
IgI_5_Dscam 504..593 CDD:409550 30/88 (34%)
Ig strand A 505..507 CDD:409550 0/1 (0%)
Ig strand A' 512..516 CDD:409550 1/3 (33%)
Ig strand B 519..526 CDD:409550 0/6 (0%)
Ig strand C 533..539 CDD:409550 2/5 (40%)
Ig strand C' 540..542 CDD:409550 0/1 (0%)
Ig strand D 549..553 CDD:409550 2/3 (67%)
Ig strand E 557..563 CDD:409550 2/5 (40%)
Ig strand F 571..579 CDD:409550 4/7 (57%)
Ig strand G 583..593 CDD:409550 3/9 (33%)
Ig 596..686 CDD:472250 40/92 (43%)
Ig strand B 613..617 CDD:409353 0/3 (0%)
Ig strand C 627..631 CDD:409353 2/3 (67%)
Ig strand E 652..656 CDD:409353 2/3 (67%)
Ig strand F 666..671 CDD:409353 3/4 (75%)
Ig strand G 679..682 CDD:409353 1/2 (50%)
Ig_DSCAM 689..784 CDD:409397 33/94 (35%)
putative Ig strand A 689..693 CDD:409397 2/3 (67%)
putative Ig strand A' 698..702 CDD:409397 1/3 (33%)
putative Ig strand B 704..714 CDD:409397 2/9 (22%)
putative Ig strand C 720..726 CDD:409397 4/5 (80%)
putative Ig strand C' 733..736 CDD:409397 0/2 (0%)
putative Ig strand D 744..747 CDD:409397 0/2 (0%)
putative Ig strand E 749..755 CDD:409397 4/5 (80%)
putative Ig strand F 762..770 CDD:409397 4/7 (57%)
putative Ig strand G 775..784 CDD:409397 2/8 (25%)
Ig_DSCAM 785..884 CDD:409398 29/101 (29%)
putative Ig strand A 785..788 CDD:409398 0/2 (0%)
putative Ig strand A' 796..800 CDD:409398 0/3 (0%)
putative Ig strand B 803..810 CDD:409398 0/6 (0%)
putative Ig strand C 818..824 CDD:409398 1/5 (20%)
putative Ig strand C' 833..836 CDD:409398 0/2 (0%)
putative Ig strand D 842..846 CDD:409398 0/3 (0%)
putative Ig strand E 848..854 CDD:409398 3/5 (60%)
putative Ig strand F 861..869 CDD:409398 3/7 (43%)
putative Ig strand G 872..882 CDD:409398 4/9 (44%)
Dscam2NP_001261500.1 Ig 30..128 CDD:472250 32/97 (33%)
Ig strand B 49..53 CDD:409353 0/3 (0%)
Ig strand C 62..66 CDD:409353 1/3 (33%)
Ig strand E 86..90 CDD:409353 3/3 (100%)
Ig strand F 106..111 CDD:409353 2/4 (50%)
Ig strand G 119..123 CDD:409353 1/3 (33%)
V-set 138..229 CDD:462230 28/90 (31%)
Ig 238..327 CDD:472250 30/89 (34%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 1/3 (33%)
Ig strand E 293..297 CDD:409353 1/3 (33%)
Ig strand F 307..312 CDD:409353 2/4 (50%)
Ig strand G 320..323 CDD:409353 0/2 (0%)
Ig 330..418 CDD:472250 23/95 (24%)
Ig strand B 348..352 CDD:409353 0/3 (0%)
Ig strand C 365..369 CDD:409353 0/3 (0%)
Ig strand E 383..387 CDD:409353 1/3 (33%)
Ig strand F 397..402 CDD:409353 3/4 (75%)
Ig strand G 411..414 CDD:409353 1/2 (50%)
IgI_4_Dscam 422..517 CDD:409548 41/94 (44%)
Ig strand A 422..425 CDD:409548 1/2 (50%)
Ig strand A' 431..435 CDD:409548 1/3 (33%)
Ig strand B 438..447 CDD:409548 4/8 (50%)
Ig strand C 452..458 CDD:409548 3/5 (60%)
Ig strand C' 460..463 CDD:409548 0/2 (0%)
Ig strand D 468..476 CDD:409548 2/7 (29%)
Ig strand E 480..489 CDD:409548 4/8 (50%)
Ig strand F 496..504 CDD:409548 4/7 (57%)
Ig strand G 507..517 CDD:409548 4/9 (44%)
IgI_5_Dscam 521..608 CDD:409550 30/87 (34%)
Ig strand A 521..523 CDD:409550 0/1 (0%)
Ig strand A' 528..532 CDD:409550 1/3 (33%)
Ig strand B 535..542 CDD:409550 0/6 (0%)
Ig strand C 549..555 CDD:409550 2/5 (40%)
Ig strand C' 556..558 CDD:409550 0/1 (0%)
Ig strand D 565..569 CDD:409550 2/4 (50%)
Ig strand E 572..578 CDD:409550 2/5 (40%)
Ig strand F 586..594 CDD:409550 4/7 (57%)
Ig strand G 598..608 CDD:409550 3/9 (33%)
Ig 611..704 CDD:472250 40/92 (43%)
Ig strand B 630..634 CDD:409353 0/3 (0%)
Ig strand C 644..648 CDD:409353 2/3 (67%)
Ig strand E 670..674 CDD:409353 2/3 (67%)
Ig strand F 684..689 CDD:409353 3/4 (75%)
Ig strand G 697..700 CDD:409353 1/2 (50%)
IgI_7_Dscam 707..802 CDD:409546 33/94 (35%)
Ig strand A 707..711 CDD:409546 2/3 (67%)
Ig strand A' 716..720 CDD:409546 1/3 (33%)
Ig strand B 723..732 CDD:409546 2/8 (25%)
Ig strand C 738..744 CDD:409546 4/5 (80%)
Ig strand C' 750..753 CDD:409546 0/2 (0%)
Ig strand D 761..764 CDD:409546 0/2 (0%)
Ig strand E 767..773 CDD:409546 4/5 (80%)
Ig strand F 780..788 CDD:409546 4/7 (57%)
Ig strand G 793..802 CDD:409546 2/8 (25%)
Ig 806..892 CDD:472250 23/86 (27%)
Ig strand B 823..827 CDD:409353 0/3 (0%)
Ig strand C 836..840 CDD:409353 0/3 (0%)
Ig strand E 868..872 CDD:409353 1/3 (33%)
Ig strand F 882..887 CDD:409353 1/4 (25%)
FN3 <904..1195 CDD:442628 104/294 (35%)
FN3 906..1006 CDD:238020 28/102 (27%)
fn3 1221..1306 CDD:394996 27/89 (30%)
Ig 1336..1396 CDD:409353 20/68 (29%)
Ig strand B 1336..1340 CDD:409353 1/3 (33%)
Ig strand E 1371..1375 CDD:409353 1/3 (33%)
Ig strand F 1385..1390 CDD:409353 3/4 (75%)
FN3 <1407..>1606 CDD:442628 68/200 (34%)
fn3 1408..1491 CDD:394996 32/83 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.