Sequence 1: | NP_001380.2 | Gene: | DSCAM / 1826 | HGNCID: | 3039 | Length: | 2012 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
Alignment Length: | 220 | Identity: | 51/220 - (23%) |
---|---|---|---|
Similarity: | 80/220 - (36%) | Gaps: | 48/220 - (21%) |
- Green bases have known domain annotations that are detailed below.
Human 594 KVPPF-IQPFEFPRFSIGQRVFIPCVVVSGDLPITITWQKDGRPIPGSLGVT-IDNIDFTS---- 652
Human 653 ---------SLRISNLSLMHNGNYTCIARN-----EAAAVEHQSQLIVRVP---------PKFVV 694
Human 695 QPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEE 759
Human 760 DSGYYLCKVSNDVGADVSKSMYLTV 784 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DSCAM | NP_001380.2 | Ig | 45..113 | CDD:319273 | |
I-set | 235..310 | CDD:254352 | |||
I-set | 315..385 | CDD:333254 | |||
Ig_3 | 407..488 | CDD:316449 | |||
IGc2 | 518..575 | CDD:197706 | |||
I-set | 596..686 | CDD:333254 | 23/109 (21%) | ||
Ig_DSCAM | 707..784 | CDD:143211 | 23/76 (30%) | ||
Ig | 802..889 | CDD:325142 | |||
FN3 | 885..978 | CDD:238020 | |||
FN3 | 986..1083 | CDD:238020 | |||
FN3 | 1091..1184 | CDD:238020 | |||
FN3 | 1189..1278 | CDD:238020 | |||
Ig | 1303..1369 | CDD:319273 | |||
FN3 | 1380..1470 | CDD:238020 | |||
FN3 | 1486..1555 | CDD:238020 | |||
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 | 1617..2012 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1718..1810 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1855..1883 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1971..2012 | ||||
ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 21/69 (30%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |