DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAM and robo1

DIOPT Version :10

Sequence 1:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens
Sequence 2:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster


Alignment Length:1297 Identity:312/1297 - (24%)
Similarity:489/1297 - (37%) Gaps:334/1297 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   375 MVKSDG-----GAYQCFVRKDKLSAQDYVQVVLEDGTPKIISAFSEKVVSPAEPVSLMCNVKGTP 434
            :|.|:|     |.||                     :|:||...::.||...||.:|.|.|:|.|
  Fly    40 LVASNGLPAVRGQYQ---------------------SPRIIEHPTDLVVKKNEPATLNCKVEGKP 83

Human   435 LPTITWTLDDDPIL--KGGSHRISQMITSEGNVVSYLNISSSQVRDGGVYRCTANNSAG-VVLYQ 496
            .|||.|..|.:|:.  :..|||:.   ..:|.:..|..:...:.:|||.|.|.|.|..| .|...
  Fly    84 EPTIEWFKDGEPVSTNEKKSHRVQ---FKDGALFFYRTMQGKKEQDGGEYWCVAKNRVGQAVSRH 145

Human   497 ARINV---RGPASIRPMKNITAIAGRDTYIHC-RVIGYPYYSIKWYKNSNLLPFN---------H 548
            |.:.:   |....:.| |:.....|....:.| ...|.|..::.|.|:.  :|.:         .
  Fly   146 ASLQIAVLRDDFRVEP-KDTRVAKGETALLECGPPKGIPEPTLIWIKDG--VPLDDLKAMSFGAS 207

Human   549 RQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVH--VTVKVPPFIQPFEFPRFSI-- 609
            .:|...:.|.|.:|:|: .:|||.|.|  :.|..:.|.:|.:  :.|:|.|:.  .:.|:..:  
  Fly   208 SRVRIVDGGNLLISNVE-PIDEGNYKC--IAQNLVGTRESSYAKLIVQVKPYF--MKEPKDQVML 267

Human   610 -GQRVFIPCVVVSGDLPITITWQKDGRPIPGSLGVTIDNIDFTSSLRISNLSLMHNGNYTCIARN 673
             ||.....| .|.||.|..:.|:|:...||.|....:.:   ..||.|||::....|.|.|.|.|
  Fly   268 YGQTATFHC-SVGGDPPPKVLWKKEEGNIPVSRARILHD---EKSLEISNITPTDEGTYVCEAHN 328

Human   674 EAAAVEHQSQLIVRVPPKFVVQPRDQD-GIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPI 737
            ....:..::.|||..||.|..:|.::. |:.| .|.|.|.|.|.|.|::.|. .:|.....| |.
  Fly   329 NVGQISARASLIVHAPPNFTKRPSNKKVGLNG-VVQLPCMASGNPPPSVFWT-KEGVSTLMF-PN 390

Human   738 ALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGADVSKSMYLTV-----KIPAMITSYPNTT 797
            :.:||..|.::|:|.|..|.:||.|||:|...:.|.:...: ::|.|     :.|.:|...|...
  Fly   391 SSHGRQHVAADGTLQITDVRQEDEGYYVCSAFSVVDSSTVR-VFLQVSSLDERPPPIIQIGPANQ 454

Human   798 LATQGQKKEMSCTAHGEKPIIVRWEKEDRIINPEMARYLVSTKEVGEEVISTLQILPTVREDSGF 862
            ...:|....:.|.|.|.....::|..:...:... .||.:...       |:|::......|||.
  Fly   455 TLPKGSVATLPCRATGNPSPRIKWFHDGHAVQAG-NRYSIIQG-------SSLRVDDLQLSDSGT 511

Human   863 FSCHAINSYGEDRGIIQLTVQEP--------------PDPPEI-EIKDVKARTITLRWTMGFD-- 910
            ::|.|....||......|||::|              |.||.. ::.:|...:|:|||....:  
  Fly   512 YTCTASGERGETSWAATLTVEKPGSTSLHRAADPSTYPAPPGTPKVLNVSRTSISLRWAKSQEKP 576

Human   911 -GNSPITGYDIE--CKNKSDSW-DSAQRTKDVSPQLNSATIIDIHPSSTYSIRMYAKNRIGKSEP 971
             ...||.||.:|  ..:....| .:|||..|     ...||..:.|.::|...:.|:|..|.|.|
  Fly   577 GAVGPIIGYTVEYFSPDLQTGWIVAAQRVGD-----TQVTISGLTPGTSYVFLVRAENTQGISVP 636

Human   972 ---SNEL-TITAD-EAAP-----------DGPPQE-VHLEPISSQSIRVTW----KAPKKHLQNG 1015
               ||.: ||.|| :||.           .|...| :....|::.::|:.|    .|.:|:    
  Fly   637 SGLSNTIKTIEADFDAASANDLSAARTLLTGKSVELIDASAINASAVRLEWMLHVSADEKY---- 697

Human  1016 IIRGYQIGYREYSTGGNFQFNIISVDTSGDSEVYTLDNLNKFTQYGLVVQACNRAGTGPSSQEII 1080
             :.|.:|.|::.|.......:|..:|.|.:|  :.:.||.|:|:|...:........|..|....
  Fly   698 -VEGLRIHYKDASVPSAQYHSITVMDASAES--FVVGNLKKYTKYEFFLTPFFETIEGQPSNSKT 759

Human  1081 TTTLEDVPSYPPENVQAIATSPESISISWSTLSKEALNGILQGFRV-IYWANLMDGELGEIKNIT 1144
            ..|.|||||.||:|:|....:..:..:.|:....:..||.|.|::: :...|.|........|.|
  Fly   760 ALTYEDVPSAPPDNIQIGMYNQTAGWVRWTPPPSQHHNGNLYGYKIEVSAGNTMKVLANMTLNAT 824

Human  1145 TTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQI--FTRTKEDVPGP---PAG---------- 1194
            ||  |:.|:.|.....||:::.:||:||||..|:.|  |......|..|   |:|          
  Fly   825 TT--SVLLNNLTTGAVYSVRLNSFTKAGDGPYSKPISLFMDPTHHVHPPRAHPSGTHDGRHEGQD 887

Human  1195 ----------------------------------------VKAAAASASMVFVSWLPPLKLNGII 1219
                                                    |...:|:.|||:..           
  Fly   888 LTYHNNGNIPPGDINPTTHKKTTDYLSGPWLMVLVCIVLLVLVISAAISMVYFK----------- 941

Human  1220 RKYTVFCSHPYPTVISEFEASPDSFSYRIPNLSRNRQYSVWV-------VAVTSAGRG------- 1270
            ||:.:.....:.:|:|:.|         |..|:.|.:.|:|:       .|.|....|       
  Fly   942 RKHQMTKELGHLSVVSDNE---------ITALNINSKESLWIDHHRGWRTADTDKDSGLSESKLL 997

Human  1271 ----------NSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPC-KAVGDPSPAVKWMKDSN 1324
                      |:|:..|  ..|:...|.||            ....| |:..:|:|....|  ..
  Fly   998 SHVNSSQSNYNNSDGGT--DYAEVDTRNLT------------TFYNCRKSPDNPTPYATTM--II 1046

Human  1325 GTPSLVTIDGRRSIFSNGSFIIRTVKAEDSGYYS--------------CIANN---------NWG 1366
            ||.|..|.....||.::          :|||.:|              .:.:|         ||.
  Fly  1047 GTSSSETCTKTTSISAD----------KDSGTHSPYSDAFAGQVPAVPVVKSNYLQYPVEPINWS 1101

Human  1367 SDEIILNLQVQVPPDQPRLTVSKTTSSSITLSWLPGD-----------NGGSSIRGYILQYSEDN 1420
            .       .:..||:.|        ..|.|..:..|.           ..|.|....||..|..:
  Fly  1102 E-------FLPPPPEHP--------PPSSTYGYAQGSPESSRKSSKSAGSGISTNQSILNASIHS 1151

Human  1421 SEQ-----WGSFP----ISPSERSYR--LENLKCGTWYKFTLTAQN-----------GVGPG 1460
            |..     ||..|    ..|.|..|.  |..:..||..::.:|..|           ..|||
  Fly  1152 SSSGGFSAWGVSPQYAVACPPENVYSNPLSAVAGGTQNRYQITPTNQHPPQLPAYFATTGPG 1213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAMNP_001380.2 FN3 885..978 CDD:238020 31/117 (26%)
FN3 <937..1300 CDD:442628 104/463 (22%)
Ig_3 1287..1363 CDD:464046 18/90 (20%)
FN3 1380..1470 CDD:238020 25/114 (22%)
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
Ig 26..121 CDD:472250
Ig strand B 42..46 CDD:409353
Ig strand C 55..59 CDD:409353
Ig strand E 79..83 CDD:409353
Ig strand F 99..104 CDD:409353
Ig strand G 112..116 CDD:409353
Ig 125..210 CDD:472250
Ig strand B 141..145 CDD:409353
Ig strand C 157..161 CDD:409353
Ig strand E 179..183 CDD:409353
Ig strand F 192..199 CDD:409353
I-set 235..310 CDD:400151
Ig strand B 242..246 CDD:409353
Ig strand C 255..259 CDD:409353
Ig strand F 290..295 CDD:409353
Ig 313..395 CDD:472250 6/24 (25%)
Ig strand B 331..335 CDD:409353
Ig strand C 344..348 CDD:409353
Ig strand E 368..372 CDD:409353
Ig strand F 382..387 CDD:409353 2/4 (50%)
Ig 406..501 CDD:472250 33/97 (34%)
Ig strand B 424..428 CDD:409353 1/3 (33%)
Ig strand C 437..441 CDD:409353 2/3 (67%)
Ig strand E 467..471 CDD:409353 1/3 (33%)
Ig strand F 481..486 CDD:409353 2/4 (50%)
Ig strand G 494..497 CDD:409353 0/2 (0%)
IgI_5_Dscam 504..593 CDD:409550 22/100 (22%)
Ig strand A 505..507 CDD:409550 0/1 (0%)
Ig strand A' 512..516 CDD:409550 0/3 (0%)
Ig strand B 519..526 CDD:409550 1/7 (14%)
Ig strand C 533..539 CDD:409550 1/5 (20%)
Ig strand C' 540..542 CDD:409550 0/1 (0%)
Ig strand D 549..553 CDD:409550 1/3 (33%)
Ig strand E 557..563 CDD:409550 2/5 (40%)
Ig strand F 571..579 CDD:409550 3/7 (43%)
Ig strand G 583..593 CDD:409550 2/11 (18%)
Ig 596..686 CDD:472250 25/92 (27%)
Ig strand B 613..617 CDD:409353 0/3 (0%)
Ig strand C 627..631 CDD:409353 0/3 (0%)
Ig strand E 652..656 CDD:409353 2/3 (67%)
Ig strand F 666..671 CDD:409353 2/4 (50%)
Ig strand G 679..682 CDD:409353 0/2 (0%)
Ig_DSCAM 689..784 CDD:409397 32/95 (34%)
putative Ig strand A 689..693 CDD:409397 2/3 (67%)
putative Ig strand A' 698..702 CDD:409397 0/4 (0%)
putative Ig strand B 704..714 CDD:409397 4/9 (44%)
putative Ig strand C 720..726 CDD:409397 1/5 (20%)
putative Ig strand C' 733..736 CDD:409397 1/2 (50%)
putative Ig strand D 744..747 CDD:409397 1/2 (50%)
putative Ig strand E 749..755 CDD:409397 3/5 (60%)
putative Ig strand F 762..770 CDD:409397 4/7 (57%)
putative Ig strand G 775..784 CDD:409397 1/8 (13%)
Ig_DSCAM 785..884 CDD:409398 22/98 (22%)
putative Ig strand A 785..788 CDD:409398 0/2 (0%)
putative Ig strand A' 796..800 CDD:409398 0/3 (0%)
putative Ig strand B 803..810 CDD:409398 0/6 (0%)
putative Ig strand C 818..824 CDD:409398 1/5 (20%)
putative Ig strand C' 833..836 CDD:409398 1/2 (50%)
putative Ig strand D 842..846 CDD:409398 0/3 (0%)
putative Ig strand E 848..854 CDD:409398 2/5 (40%)
putative Ig strand F 861..869 CDD:409398 3/7 (43%)
putative Ig strand G 872..882 CDD:409398 3/9 (33%)
robo1NP_476899.1 Ig 56..151 CDD:472250 33/97 (34%)
Ig strand B 73..77 CDD:409353 1/3 (33%)
Ig strand C 86..90 CDD:409353 2/3 (67%)
Ig strand E 111..115 CDD:409353 1/3 (33%)
Ig strand F 129..134 CDD:409353 2/4 (50%)
Ig strand G 143..146 CDD:409353 0/2 (0%)
IgI_2_Robo 158..251 CDD:409389 22/98 (22%)
Ig strand A 158..161 CDD:409389 0/2 (0%)
Ig strand A' 163..167 CDD:409389 0/3 (0%)
Ig strand B 171..178 CDD:409389 1/6 (17%)
Ig strand C 186..191 CDD:409389 1/4 (25%)
Ig strand C' 193..196 CDD:409389 0/4 (0%)
Ig strand D 209..213 CDD:409389 1/3 (33%)
Ig strand E 216..222 CDD:409389 2/5 (40%)
Ig strand F 229..237 CDD:409389 3/9 (33%)
Ig strand G 240..251 CDD:409389 2/10 (20%)
IgI_3_Robo 258..341 CDD:409390 24/86 (28%)
Ig strand A 258..261 CDD:409390 0/2 (0%)
Ig strand A' 263..267 CDD:409390 0/3 (0%)
Ig strand B 270..279 CDD:409390 2/9 (22%)
Ig strand C 285..290 CDD:409390 1/4 (25%)
Ig strand C' 293..296 CDD:409390 0/2 (0%)
Ig strand D 299..304 CDD:409390 0/4 (0%)
Ig strand E 305..313 CDD:409390 3/10 (30%)
Ig strand F 320..328 CDD:409390 4/7 (57%)
Ig strand G 331..341 CDD:409390 1/9 (11%)
Ig 346..437 CDD:472250 30/94 (32%)
Ig strand B 362..366 CDD:409353 2/3 (67%)
Ig strand C 375..379 CDD:409353 0/3 (0%)
Ig strand E 402..406 CDD:409353 2/3 (67%)
Ig strand F 416..421 CDD:409353 3/4 (75%)
Ig strand G 429..432 CDD:409353 0/3 (0%)
Ig 446..531 CDD:472250 19/92 (21%)
Ig strand B 462..466 CDD:409544 0/3 (0%)
Ig strand C 475..479 CDD:409544 0/3 (0%)
Ig strand E 497..501 CDD:409544 2/3 (67%)
FN3 507..>916 CDD:442628 107/422 (25%)
Ig strand F 511..516 CDD:409544 1/4 (25%)
Ig strand G 524..527 CDD:409544 0/2 (0%)
FN3 549..637 CDD:238020 26/92 (28%)
fn3 770..855 CDD:394996 26/86 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.