DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAM and Lac

DIOPT Version :9

Sequence 1:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:397 Identity:86/397 - (21%)
Similarity:139/397 - (35%) Gaps:123/397 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   123 REPYTVRVEDQKTMR--GNVAVFKCIIPSSVEAYITVVSWEKDTVSLVSGSRFLI---------- 175
            |.| |:....|:.::  |....|.|.:..:.|..:..:..:.|.|.|.:||..:|          
  Fly    27 RTP-TISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYD 90

Human   176 --TSTGALYIKDVQNED-GLYNYRCI--TRHRYTGETRQSNSARLFVSDPANSAPSILDGFDHRK 235
              :||..|.|||:|..| |.|..:.:  |.|:.:.|.:.|......:||  ||..|::       
  Fly    91 PNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISD--NSTQSVV------- 146

Human   236 AMAGQRVELPCKALGHPEPDYRWLKDNMPLELSGRFQKTVTGLLIENIRPSDSGSYVCEVSNRYG 300
            |..|..|::.|.|.|:|.|...|.::|                  ..|.|:||.:||        
  Fly   147 ASEGSEVQMECYASGYPTPTITWRREN------------------NAILPTDSATYV-------- 185

Human   301 TAKVIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGTEDQELSWYRNGEILNPGKNVRITGI 365
                                                                    |..:||..:
  Fly   186 --------------------------------------------------------GNTLRIKSV 194

Human   366 NHENLIMDHMVKSDGGAYQCFVRKDKLSAQDYVQVVLEDGTPKIISAFSEKVVSPAE-PVSLMCN 429
            .          |.|.|.|.| |..:.:|..|...:.:|.....:|:....::....: .:.|.|:
  Fly   195 K----------KEDRGTYYC-VADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECH 248

Human   430 VKGTPLPTITWTLDDDPILKGGSHRISQMITSEGNVVSYLNISSSQVRDGGVYRCTANNSAGVVL 494
            ::..|.|.|.||.||..:.....:.||...|::....|.|.:.:.:.|..|.|.|.|.|..|.. 
  Fly   249 IEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEA- 312

Human   495 YQARINV 501
             :||:|:
  Fly   313 -EARVNL 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352 16/74 (22%)
I-set 315..385 CDD:333254 7/69 (10%)
Ig_3 407..488 CDD:316449 20/81 (25%)
IGc2 518..575 CDD:197706
I-set 596..686 CDD:333254
Ig_DSCAM 707..784 CDD:143211
Ig 802..889 CDD:325142
FN3 885..978 CDD:238020
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
LacNP_523713.2 IG_like 36..131 CDD:214653 24/94 (26%)
FR1 37..50 CDD:409353 2/12 (17%)
Ig strand A' 37..42 CDD:409353 0/4 (0%)
Ig strand B 44..51 CDD:409353 1/6 (17%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
FR2 60..63 CDD:409353 0/2 (0%)
CDR2 67..81 CDD:409353 5/13 (38%)
Ig strand C' 68..72 CDD:409353 2/3 (67%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 10/30 (33%)
Ig strand D 84..90 CDD:409353 0/5 (0%)
Ig strand E 94..102 CDD:409353 4/7 (57%)
Ig strand F 108..115 CDD:409353 2/6 (33%)
CDR3 116..124 CDD:409353 2/7 (29%)
FR4 124..130 CDD:409353 1/5 (20%)
Ig strand G 124..130 CDD:409353 1/5 (20%)
Ig_3 134..208 CDD:404760 30/175 (17%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 0/3 (0%)
Ig strand E 187..191 CDD:409353 0/3 (0%)
Ig strand F 201..206 CDD:409353 2/5 (40%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 24/92 (26%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.