DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAM and DIP-zeta

DIOPT Version :9

Sequence 1:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:579 Identity:127/579 - (21%)
Similarity:170/579 - (29%) Gaps:181/579 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   463 GNVVSYLNISSSQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRV 527
            |..|:.....|:.|...||  ..|...|.|......|.|..|.....::|:|..|||:..:.|.|
  Fly    74 GGPVAGSGTGSTVVGSNGV--IVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSV 136

Human   528 IGYPYYSIKW--YKNSNLLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVH 590
            .....|.:.|  ::.|.:|.. |..|...|                         |::|.:...|
  Fly   137 KNLGSYKVAWMHFEQSAILTV-HNHVITRN-------------------------PRISVTHDKH 175

Human   591 VTVKVPPFIQPFEFPRFSIGQRVFIPCVVVSGDLPITITWQKDGRPIPGSLGVTIDNIDFTSSLR 655
            ...:                                  ||.                      |.
  Fly   176 DRHR----------------------------------TWY----------------------LH 184

Human   656 ISNLSLMHNGNYTCIARNEAAAVEHQSQLIVRVPPKFVVQPRDQDGIY--GKAVILNCSAEGYPV 718
            |:|:.....|.|.| ..|...|......|.|.|||.........|.|.  |..:.|.|.|.|.|.
  Fly   185 INNVHEEDRGRYMC-QINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPR 248

Human   719 PTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEE--------------DSGYYLCKVS 769
            |.|.||...            |.||.:..|      |:|.|              |.|.|||..|
  Fly   249 PIIKWKRDD------------NSRIAINKN------HIVNEWEGDTLEITRISRLDMGAYLCIAS 295

Human   770 NDVGADVSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRWEKEDRIINPEMAR 834
            |.|...|||.:.::|..|.|:........|.:|....:.|........:..|.:.:..|..:..:
  Fly   296 NGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHK 360

Human   835 YLVSTKEVGEEVIST---LQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPDPPEIEIKDV 896
            |.|.. .||.....|   |.|:.....|.|.:.|.|.|..||..|||:|.|..||......|...
  Fly   361 YKVEA-TVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYST 424

Human   897 KARTITLRW-TMGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSIRM 960
            ..     .| ..|.:.|....|                                  |.||.||  
  Fly   425 DT-----HWGENGINNNYAYGG----------------------------------PDSTRSI-- 448

Human   961 YAK----------NRIGKSEPSNELTITADEAAPDGPPQEVHLEPISSQ----SIRVTW 1005
            ||:          |.||.||..:.|..|.:....:|...|...|...::    |:.:.|
  Fly   449 YAQDKNTRYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEADAESNGARGHNPSMAIAW 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352
I-set 315..385 CDD:333254
Ig_3 407..488 CDD:316449 7/24 (29%)
IGc2 518..575 CDD:197706 11/58 (19%)
I-set 596..686 CDD:333254 11/89 (12%)
Ig_DSCAM 707..784 CDD:143211 27/90 (30%)
Ig 802..889 CDD:325142 25/89 (28%)
FN3 885..978 CDD:238020 20/103 (19%)
FN3 986..1083 CDD:238020 5/24 (21%)
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 29/178 (16%)
Ig 130..200 CDD:143165 20/152 (13%)
I-set 226..310 CDD:254352 30/101 (30%)
IGc2 233..298 CDD:197706 24/82 (29%)
Ig 313..410 CDD:299845 25/97 (26%)
IG_like 325..410 CDD:214653 23/85 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.