DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAM and bdl

DIOPT Version :10

Sequence 1:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:724 Identity:168/724 - (23%)
Similarity:266/724 - (36%) Gaps:210/724 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   434 PLP-TITWTLDDDPILKGGSHR--ISQMITSEGNVV--------SYLNISSSQVRDGGVYRCTA- 486
            |:| .:.||.|:..|.......  .|::.....::|        :.:|:::.:..|.|.|.|.. 
  Fly    64 PIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVS 128

Human   487 --NNSAGV----VLYQARINVRGPASIR-PMKNITAIAGRDTYIHCRVIGYPYYS-IKWYKNSNL 543
              |.|..|    ..|  .:.|:|.:.|| |..|.|...|:..:.|| |:.:|..| ..|||:..|
  Fly   129 FPNRSPSVRNNGTAY--HLAVQGGSLIRIPPVNQTIREGQTAFFHC-VMKHPENSQASWYKDGVL 190

Human   544 LPFNH---RQVAFENNGTLKLSDVQKEVDEGEYTCNVL-VQPQLSTSQ---SVHVTVKV----PP 597
            |....   |:.....:|:|.: |.....|.|||.|.|. ...:|.|::   ::....||    |.
  Fly   191 LQEVQDLVRRFYMGPDGSLSI-DPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPE 254

Human   598 FIQPFEFPRFSIGQRVFIPCVVVSGDLPITITWQKDG-----RPIPGSLGVTIDNIDFTSSLRIS 657
            ...|:       ||...:.|...:......:.|:|||     ..:||..      .....||..:
  Fly   255 VFLPY-------GQPAVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGVF------YKMNGSLFFA 306

Human   658 NLSLMHNGNYTCIARNEAAAVEHQS---QLIVRVPPKFVVQPRDQDGIY----GKAVILNCSA-- 713
            .:...|.|:|||...|: ...:..|   .:||..||.|.|.|:   .||    |:|..|.|.|  
  Fly   307 KVDENHAGSYTCTPYND-LGTDGPSPVISVIVLRPPIFSVTPK---AIYIQKLGEAAELPCEAID 367

Human   714 -EGYPVPTIVWKFSKGAGVP--QFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGAD 775
             :|...|:|:|....|..:|  :|.          ||.|:|.|..:||.|.|.|.|..:|: .|.
  Fly   368 RDGNNRPSIIWGRKDGQPLPADRFS----------LSGGNLTITGLVEGDRGIYECSATNE-AAT 421

Human   776 VSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRWEKEDRIINPEMARYLVSTK 840
            ::....|.::..|....|..|..:|:      :|       |.:||  :...:.|.: .|.|..:
  Fly   422 ITAEAELMIENIAPRAPYNLTANSTE------TC-------ITIRW--QPGYLRPNL-EYTVWYR 470

Human   841 EVGEEVISTLQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPDPPEIEI------------ 893
            .:......||::|                    |:.:::.|||......|.|.            
  Fly   471 LMEAPEWRTLRVL--------------------DKKVMEATVQHLQPGKEYEFMVLSQDKYGDGM 515

Human   894 --KDVKARTITLRWTMGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTY 956
              |..:.:|:.          |||         ::|.:|:.|...|    |...|.    |:.  
  Fly   516 FSKQFRFQTLP----------SPI---------RADDFDAQQLQHD----LGQVTA----PAG-- 551

Human   957 SIRMYAKNRIGKSEPSNELTITADEAA----PDGPPQEVHLEPISSQSIRVTWKAPKKHLQNGII 1017
                      |...|.| ||..:::..    .:.|.|  .||.:...::| .||.|:..|     
  Fly   552 ----------GLGAPWN-LTAISNQQGWLLHWEHPVQ--GLEGLRLYAVR-WWKEPEHFL----- 597

Human  1018 RGYQIGYREYSTGGNFQFNIISVDTSGDSEVYTLDNLNKFTQYGLVVQACNRAGTGPSSQEIITT 1082
                ||:.|  |..|:               |.|.:|.:.|.:.:.|.|     .|..:|:.:.:
  Fly   598 ----IGHAE--TFDNY---------------YQLRHLKEDTLFKVQVLA-----VGTETQQSVPS 636

Human  1083 --TLEDVPS 1089
              .|.||||
  Fly   637 HELLIDVPS 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAMNP_001380.2 FN3 885..978 CDD:238020 19/106 (18%)
FN3 <937..1300 CDD:442628 36/159 (23%)
Ig_3 1287..1363 CDD:464046
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
Ig 26..121 CDD:472250
Ig strand B 42..46 CDD:409353
Ig strand C 55..59 CDD:409353
Ig strand E 79..83 CDD:409353
Ig strand F 99..104 CDD:409353
Ig strand G 112..116 CDD:409353
Ig 125..210 CDD:472250
Ig strand B 141..145 CDD:409353
Ig strand C 157..161 CDD:409353
Ig strand E 179..183 CDD:409353
Ig strand F 192..199 CDD:409353
I-set 235..310 CDD:400151
Ig strand B 242..246 CDD:409353
Ig strand C 255..259 CDD:409353
Ig strand F 290..295 CDD:409353
Ig 313..395 CDD:472250
Ig strand B 331..335 CDD:409353
Ig strand C 344..348 CDD:409353
Ig strand E 368..372 CDD:409353
Ig strand F 382..387 CDD:409353
Ig 406..501 CDD:472250 17/84 (20%)
Ig strand B 424..428 CDD:409353
Ig strand C 437..441 CDD:409353 0/3 (0%)
Ig strand E 467..471 CDD:409353 0/3 (0%)
Ig strand F 481..486 CDD:409353 2/4 (50%)
Ig strand G 494..497 CDD:409353 1/2 (50%)
IgI_5_Dscam 504..593 CDD:409550 28/97 (29%)
Ig strand A 505..507 CDD:409550 0/1 (0%)
Ig strand A' 512..516 CDD:409550 2/3 (67%)
Ig strand B 519..526 CDD:409550 1/6 (17%)
Ig strand C 533..539 CDD:409550 2/6 (33%)
Ig strand C' 540..542 CDD:409550 0/1 (0%)
Ig strand D 549..553 CDD:409550 1/3 (33%)
Ig strand E 557..563 CDD:409550 2/5 (40%)
Ig strand F 571..579 CDD:409550 5/8 (63%)
Ig strand G 583..593 CDD:409550 2/12 (17%)
Ig 596..686 CDD:472250 20/97 (21%)
Ig strand B 613..617 CDD:409353 0/3 (0%)
Ig strand C 627..631 CDD:409353 0/3 (0%)
Ig strand E 652..656 CDD:409353 2/3 (67%)
Ig strand F 666..671 CDD:409353 3/4 (75%)
Ig strand G 679..682 CDD:409353 0/2 (0%)
Ig_DSCAM 689..784 CDD:409397 33/103 (32%)
putative Ig strand A 689..693 CDD:409397 2/3 (67%)
putative Ig strand A' 698..702 CDD:409397 0/3 (0%)
putative Ig strand B 704..714 CDD:409397 5/12 (42%)
putative Ig strand C 720..726 CDD:409397 2/5 (40%)
putative Ig strand C' 733..736 CDD:409397 1/2 (50%)
putative Ig strand D 744..747 CDD:409397 0/2 (0%)
putative Ig strand E 749..755 CDD:409397 3/5 (60%)
putative Ig strand F 762..770 CDD:409397 3/7 (43%)
putative Ig strand G 775..784 CDD:409397 1/8 (13%)
Ig_DSCAM 785..884 CDD:409398 17/98 (17%)
putative Ig strand A 785..788 CDD:409398 0/2 (0%)
putative Ig strand A' 796..800 CDD:409398 1/3 (33%)
putative Ig strand B 803..810 CDD:409398 0/6 (0%)
putative Ig strand C 818..824 CDD:409398 2/5 (40%)
putative Ig strand C' 833..836 CDD:409398 0/2 (0%)
putative Ig strand D 842..846 CDD:409398 0/3 (0%)
putative Ig strand E 848..854 CDD:409398 2/5 (40%)
putative Ig strand F 861..869 CDD:409398 0/7 (0%)
putative Ig strand G 872..882 CDD:409398 1/9 (11%)
bdlNP_608822.1 IG_like 42..128 CDD:214653 13/63 (21%)
Ig strand C 69..72 CDD:409512 0/2 (0%)
Ig strand E 108..112 CDD:409512 0/3 (0%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 28/90 (31%)
Ig strand B 168..172 CDD:409544 0/3 (0%)
Ig strand C 181..185 CDD:409544 0/3 (0%)
Ig strand E 207..211 CDD:409544 2/3 (67%)
Ig strand F 221..226 CDD:409544 3/4 (75%)
Ig strand G 235..238 CDD:409544 1/2 (50%)
Ig_3 247..322 CDD:464046 20/87 (23%)
Ig 341..428 CDD:472250 31/100 (31%)
Ig strand B 359..363 CDD:409353 1/3 (33%)
Ig strand C 375..380 CDD:409353 2/4 (50%)
Ig strand E 396..400 CDD:409353 2/3 (67%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353 0/2 (0%)
FN3 435..524 CDD:238020 20/124 (16%)
FN3 554..636 CDD:238020 26/116 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.