DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAM and CG33543

DIOPT Version :9

Sequence 1:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:464 Identity:117/464 - (25%)
Similarity:179/464 - (38%) Gaps:94/464 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   576 NVLVQPQL-STSQSVHVTVKVPP--------FIQPFEFPRFS--IGQRVFIPCVVVSGDLPITIT 629
            |..:..|| |||.....|...||        .:|| ..|..:  :.:...|.|..|..|  |...
  Fly    18 NAAILGQLDSTSSGGSGTGGAPPDRPPTPPLSLQP-STPSITHFVNESFIIFCQTVQKD--IDTK 79

Human   630 WQKDGRPIPGSLGVTIDN------IDFTS----SLRISNLSLMHNGNYTCIAR-----NEAAAVE 679
            | :|.|      |.|.:|      |:..:    :|...:::|...||:||...     |....||
  Fly    80 W-RDPR------GQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVE 137

Human   680 HQ----SQLIVRVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALN 740
            .:    .:|:|.....|....:.|....|:..::||..||.|.|.:.|.:: |..:........|
  Fly   138 REFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYN-GEYINTVNSTKHN 201

Human   741 GRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGADVSKSMYLTVKIPAMITSYP----NTTLATQ 801
            .    |||| |.|::|.:.|:|.|.|:... :....|.|..:|:.:  .|...|    |.||..|
  Fly   202 R----LSNG-LYIRNVSQADAGEYTCRAMR-ITPTFSDSDQITILL--RIQHKPHWFFNETLPVQ 258

Human   802 ----GQKKEMSCTAHGEKPIIVRWEKEDRIINPEMARYLVSTKEVGEEVISTLQILPTVREDSGF 862
                |....:||.|.||.|....|...::.|.....|..|:  :.|    :|||:........|.
  Fly   259 YAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVA--DYG----ATLQLQMKNASQFGD 317

Human   863 FSCHAINSYGEDRGIIQLTV-QEPPDPPEIEIKDVKARTITLRWTMGF--DGNSP---------- 914
            :.|...|..|....:|:|.. .:|..|...::|.:        :|.||  |..:|          
  Fly   318 YKCKVANPLGMLERVIKLRPGPKPLGPRRFQLKKL--------YTNGFELDIQTPRMSNVSDEMQ 374

Human   915 ITGY------DIECKNKSDSWDSAQRTKDVSPQLNSATII-DIHPSSTYSIRMYAKNRIGKSE-- 970
            |.||      |.|.|..:.:|..|:: :|.|.......|| .:..::||.:|..::|..|.|:  
  Fly   375 IYGYRVAYMSDTEFKFSAGNWSYAKQ-RDFSFHGGKHFIIPHLETNTTYLMRAASRNLAGLSDWS 438

Human   971 PSNELTITA 979
            |....|..|
  Fly   439 PVKVFTTAA 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352
I-set 315..385 CDD:333254
Ig_3 407..488 CDD:316449
IGc2 518..575 CDD:197706
I-set 596..686 CDD:333254 27/118 (23%)
Ig_DSCAM 707..784 CDD:143211 22/76 (29%)
Ig 802..889 CDD:325142 22/87 (25%)
FN3 885..978 CDD:238020 28/113 (25%)
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 21/64 (33%)
IG_like 256..336 CDD:214653 21/85 (25%)
IGc2 263..327 CDD:197706 18/69 (26%)
FN3 341..445 CDD:238020 27/112 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.