DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAM and DIP-beta

DIOPT Version :9

Sequence 1:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:400 Identity:100/400 - (25%)
Similarity:149/400 - (37%) Gaps:80/400 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   596 PPFIQPFEFPRFSIGQRVFIPCVV-------VSGD---LPITITWQK-DGRPIPGSLGVTIDNID 649
            |.|:.|.|....:.|:.....|||       ||||   .|..:.|.| |.:.|.......|.|.|
  Fly    98 PDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNND 162

Human   650 FTS---------SLRISNLSLMHNGNYTCIARNEAAAVEHQSQLIVRVPPKFVVQPRDQDGIY-- 703
            ..|         :|.|..:.:...|.|.|....:...:: .:.|.|.:||..:.:....|.:.  
  Fly   163 RLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQ-TATLEVVIPPDIINEETSGDMMVPE 226

Human   704 GKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNG-----RIQVLSNGSLLIKHVVEEDSGY 763
            |.:..|.|.|.|:|.|.|.|:...|..:     ||.||     :.|.:....|.:..:...:.|.
  Fly   227 GGSAKLVCRARGHPKPKITWRREDGREI-----IARNGSHQKTKAQSVEGEMLTLSKITRSEMGA 286

Human   764 YLCKVSNDVGADVSKSMYL------TVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRWE 822
            |:|..||.|...|||.|.|      .|::|..:...|..|..|      :.|........|..|:
  Fly   287 YMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVT------LICNVEASPKAINYWQ 345

Human   823 KEDRIINPEMA----RYLVSTKEVGEEVIS-TLQILPTVREDSGFFSCHAINSYGEDRGIIQLTV 882
            :|    |.||.    ||.::.||.....|. .|.|......|.|.:.|.:.||.|:..|.|:|..
  Fly   346 RE----NGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYE 406

Human   883 QEPPDPP---EIEIKDVKARTITLRWTMGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNS 944
            .|.|...   :.::.:|....:..:.|...||:..:.|               :..||.:|    
  Fly   407 MERPGKKILRDDDLNEVSKNEVVQKDTRSEDGSRNLNG---------------RLYKDRAP---- 452

Human   945 ATIIDIHPSS 954
                |.||:|
  Fly   453 ----DQHPAS 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352
I-set 315..385 CDD:333254
Ig_3 407..488 CDD:316449
IGc2 518..575 CDD:197706
I-set 596..686 CDD:333254 27/109 (25%)
Ig_DSCAM 707..784 CDD:143211 26/87 (30%)
Ig 802..889 CDD:325142 25/91 (27%)
FN3 885..978 CDD:238020 12/72 (17%)
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 28/111 (25%)
ig 102..195 CDD:278476 24/92 (26%)
IG_like 219..307 CDD:214653 28/92 (30%)
Ig 221..307 CDD:299845 28/90 (31%)
Ig 311..404 CDD:299845 27/102 (26%)
IG_like 327..405 CDD:214653 23/87 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.