DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAM and Fas2

DIOPT Version :10

Sequence 1:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:715 Identity:180/715 - (25%)
Similarity:292/715 - (40%) Gaps:114/715 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   469 LNISSSQVRDGGVYRCTANNSAGVVLYQARINVRGPASI---RPMKNITAIAGRDTYIHCRVIGY 530
            |.|:|..|..||.|.||| :.|...:.:..:.::...:|   ...:|.....|:|..:.|.|...
  Fly   101 LMITSLSVEMGGKYYCTA-SYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKAD 164

Human   531 PYYSIKWYKNSNLLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKV 595
            |..:|.|.:|.:.:...:.:...:.||.| :.:|| |.|||.|||...|   :.|.:.:..|::|
  Fly   165 PNPTIDWLRNGDPIRTTNDKYVVQTNGLL-IRNVQ-ESDEGIYTCRAAV---IETGELLERTIRV 224

Human   596 PPFIQPFEFPRFSIGQRVFIP--CVVVSGDLPITITWQKDGRPIP--------GSLGV-TIDNID 649
            ..||||         :.:.:|  ...|.|. |........|:|:|        ..|.| |.|...
  Fly   225 EVFIQP---------EIISLPTNLEAVEGK-PFAANCTARGKPVPEISWIRDATQLNVATADRFQ 279

Human   650 F---TSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQLIVRVPPKFVVQPRDQDGIYGKAVILNC 711
            .   |..:.||::|....|.|||:|:|.|..|:.:::|.|.|.|: :.:..:..|...|.:.:.|
  Fly   280 VNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQ-IYELYNVTGARTKEIAITC 343

Human   712 SAEGYPVPTIVWK-------FSKGAG--------VPQFQPIALNGRIQVLSNGSLLIKHVVEEDS 761
            .|:|.|.|.|.::       ::.|..        .|.|.  ...|.    |.|:|.|.:....|.
  Fly   344 RAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFD--EERGE----STGTLRISNAERSDD 402

Human   762 GYYLCKVSNDVGADVSKSMYLTVKIP---AMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRWEK 823
            |.|.| ::.:.|||..|:.::||:..   :.:...| ...:.:.:|..:||.|.|.....:.|..
  Fly   403 GLYQC-IARNKGADAYKTGHITVEFAPDFSHMKELP-PVFSWEQRKANLSCLAMGIPNATIEWHW 465

Human   824 EDRIINPEMARYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPDP 888
            ..|.|..   .|..:.|.||....|.|.:.|..|:....:.|.|.|.:|.....:||.....|| 
  Fly   466 NGRKIKD---LYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARVPD- 526

Human   889 PEIEIKDVKARTITLRWTMGFD--GNS-----PITGYDIECKNK-SDSWDSAQRTKDVSPQLNSA 945
               .:.:.|...:|.. ||.||  |.|     ||..|.::.|.. :..|.:|. .:..||  :|.
  Fly   527 ---FVSEAKPSQLTAT-TMTFDIRGPSTELGLPILAYSVQYKEALNPDWSTAY-NRSWSP--DSP 584

Human   946 TIID-IHPSSTYSIRMYAKNRIGKSE-PSNELTITADEAAPD------GPPQEVHLEPI----SS 998
            .|:: :.|.:.||.|..|:|::|... ..|:...|...:||:      .|.|....||:    .|
  Fly   585 YIVEGLRPQTEYSFRFAARNQVGLGNWGVNQQQSTPRRSAPEEPKPLHNPVQHDKEEPVVVSPYS 649

Human   999 QSIRVTWKAPKKHLQNG-IIRGYQIGYREYSTGGNFQFNIISVDTSGDS-EV-----YTLDNLNK 1056
            ....:.|..|   ..|| .|..|||   :|..|.........::.|.:: ||     :.:..|..
  Fly   650 DHFELRWGVP---ADNGEPIDRYQI---KYCPGVKISGTWTELENSCNTVEVMETTSFEMTQLVG 708

Human  1057 FTQYGLVVQACNRAGTGPSSQEIITTTLEDVPSYPPENVQAIATSPESISISWSTLSKEALNGIL 1121
            .|.|.:.::|.|..|....:..|:.||         ..:..|..:...: .|.:.:...|:.|:|
  Fly   709 NTYYRIELKAHNAIGYSSPASIIMKTT---------RGIDVIQVAERQV-FSSAAIVGIAIGGVL 763

Human  1122  1121
              Fly   764  763

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAMNP_001380.2 FN3 885..978 CDD:238020 28/102 (27%)
FN3 <937..1300 CDD:442628 47/204 (23%)
Ig_3 1287..1363 CDD:464046
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
Ig 26..121 CDD:472250
Ig strand B 42..46 CDD:409353
Ig strand C 55..59 CDD:409353
Ig strand E 79..83 CDD:409353
Ig strand F 99..104 CDD:409353
Ig strand G 112..116 CDD:409353
Ig 125..210 CDD:472250
Ig strand B 141..145 CDD:409353
Ig strand C 157..161 CDD:409353
Ig strand E 179..183 CDD:409353
Ig strand F 192..199 CDD:409353
I-set 235..310 CDD:400151
Ig strand B 242..246 CDD:409353
Ig strand C 255..259 CDD:409353
Ig strand F 290..295 CDD:409353
Ig 313..395 CDD:472250
Ig strand B 331..335 CDD:409353
Ig strand C 344..348 CDD:409353
Ig strand E 368..372 CDD:409353
Ig strand F 382..387 CDD:409353
Ig 406..501 CDD:472250 11/31 (35%)
Ig strand B 424..428 CDD:409353
Ig strand C 437..441 CDD:409353
Ig strand E 467..471 CDD:409353 1/1 (100%)
Ig strand F 481..486 CDD:409353 2/4 (50%)
Ig strand G 494..497 CDD:409353 0/2 (0%)
IgI_5_Dscam 504..593 CDD:409550 24/91 (26%)
Ig strand A 505..507 CDD:409550 0/1 (0%)
Ig strand A' 512..516 CDD:409550 1/3 (33%)
Ig strand B 519..526 CDD:409550 1/6 (17%)
Ig strand C 533..539 CDD:409550 2/5 (40%)
Ig strand C' 540..542 CDD:409550 1/1 (100%)
Ig strand D 549..553 CDD:409550 0/3 (0%)
Ig strand E 557..563 CDD:409550 2/5 (40%)
Ig strand F 571..579 CDD:409550 4/7 (57%)
Ig strand G 583..593 CDD:409550 1/9 (11%)
Ig 596..686 CDD:472250 28/103 (27%)
Ig strand B 613..617 CDD:409353 1/5 (20%)
Ig strand C 627..631 CDD:409353 0/3 (0%)
Ig strand E 652..656 CDD:409353 0/3 (0%)
Ig strand F 666..671 CDD:409353 3/4 (75%)
Ig strand G 679..682 CDD:409353 0/2 (0%)
Ig_DSCAM 689..784 CDD:409397 25/109 (23%)
putative Ig strand A 689..693 CDD:409397 1/3 (33%)
putative Ig strand A' 698..702 CDD:409397 0/3 (0%)
putative Ig strand B 704..714 CDD:409397 2/9 (22%)
putative Ig strand C 720..726 CDD:409397 1/12 (8%)
putative Ig strand C' 733..736 CDD:409397 1/2 (50%)
putative Ig strand D 744..747 CDD:409397 0/2 (0%)
putative Ig strand E 749..755 CDD:409397 3/5 (60%)
putative Ig strand F 762..770 CDD:409397 3/7 (43%)
putative Ig strand G 775..784 CDD:409397 2/8 (25%)
Ig_DSCAM 785..884 CDD:409398 23/101 (23%)
putative Ig strand A 785..788 CDD:409398 0/5 (0%)
putative Ig strand A' 796..800 CDD:409398 0/3 (0%)
putative Ig strand B 803..810 CDD:409398 2/6 (33%)
putative Ig strand C 818..824 CDD:409398 1/5 (20%)
putative Ig strand C' 833..836 CDD:409398 0/2 (0%)
putative Ig strand D 842..846 CDD:409398 2/3 (67%)
putative Ig strand E 848..854 CDD:409398 2/5 (40%)
putative Ig strand F 861..869 CDD:409398 2/7 (29%)
putative Ig strand G 872..882 CDD:409398 3/9 (33%)
Fas2NP_001284854.1 Ig 33..121 CDD:472250 10/20 (50%)
Ig strand B 50..54 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 99..103 CDD:409353 1/1 (100%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 21/71 (30%)
Ig strand B 156..159 CDD:409353 0/2 (0%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 190..194 CDD:409353 3/4 (75%)
Ig strand F 204..209 CDD:409353 3/4 (75%)
IgI_4_MYLK-like 229..319 CDD:409568 26/99 (26%)
Ig strand A 229..232 CDD:409568 2/11 (18%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 1/7 (14%)
Ig strand C 260..264 CDD:409568 0/3 (0%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 0/3 (0%)
Ig strand E 285..290 CDD:409568 0/4 (0%)
Ig strand F 298..306 CDD:409568 5/7 (71%)
Ig strand G 309..319 CDD:409568 2/9 (22%)
IG_like 330..424 CDD:214653 24/100 (24%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 1/3 (33%)
Ig strand E 388..394 CDD:409353 3/5 (60%)
Ig strand F 404..409 CDD:409353 2/5 (40%)
Ig 447..515 CDD:409353 19/70 (27%)
Ig strand B 447..451 CDD:409353 0/3 (0%)
Ig strand C 460..464 CDD:409353 0/3 (0%)
Ig strand E 487..491 CDD:409353 2/3 (67%)
Ig strand F 501..506 CDD:409353 1/4 (25%)
FN3 525..619 CDD:238020 28/101 (28%)
FN3 640..735 CDD:238020 23/100 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.