DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAM and DIP-alpha

DIOPT Version :9

Sequence 1:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:410 Identity:87/410 - (21%)
Similarity:131/410 - (31%) Gaps:133/410 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   504 PASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYK---------NSNLLPFNHRQVAF---ENN 556
            |..:..:.|::...|||....|.|.....|.:.|.|         :.|::..|.|....   :|.
  Fly    42 PEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNT 106

Human   557 GTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFIQPFEFPRFSIGQRVFIPCVVVS 621
            ..|.:..|.:| |.|.|.|      ||:|.                                   
  Fly   107 WNLHIKAVSEE-DRGGYMC------QLNTD----------------------------------- 129

Human   622 GDLPITITWQKDGRPIPGSLGVTIDNIDFTSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQLIV 686
                          |:...:|.                                        |.|
  Fly   130 --------------PMKSQIGF----------------------------------------LDV 140

Human   687 RVPPKFVVQPRDQDGIY--GKAVILNCSAEGYPVPTIVWKFSKG--------AGVPQFQPIALNG 741
            .:||.|:.:....|.|.  |.:|.|.|.|.|||.|.:.|:...|        .|.....| :..|
  Fly   141 VIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAP-SFRG 204

Human   742 RIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGADVSKSMYLTVKIPAMITSYPNTTL-ATQGQKK 805
            .:..||.       :...:.|.|||..||.|...|||.:.|::....:| ..||..: |..|...
  Fly   205 EVLKLSK-------ISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVI-QVPNQLVGAPLGTDV 261

Human   806 EMSCTAHGEKPIIVRWEKEDRIINPEMARYLV--STKEVGEEVISTLQILPTVREDSGFFSCHAI 868
            ::.|........|..|.|:...:.....:|.|  |::.:.|..:|.: :....::|.|.:.|.|.
  Fly   262 QIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMI-VRKFQKDDVGSYRCIAK 325

Human   869 NSYGEDRGIIQLTVQEPPDP 888
            ||.||....|:|  .|.|.|
  Fly   326 NSLGEVDSSIRL--YEIPGP 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352
I-set 315..385 CDD:333254
Ig_3 407..488 CDD:316449
IGc2 518..575 CDD:197706 18/68 (26%)
I-set 596..686 CDD:333254 3/89 (3%)
Ig_DSCAM 707..784 CDD:143211 26/84 (31%)
Ig 802..889 CDD:325142 23/89 (26%)
FN3 885..978 CDD:238020 2/4 (50%)
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 22/86 (26%)
Ig 51..131 CDD:299845 22/135 (16%)
I-set 144..240 CDD:254352 31/103 (30%)
IGc2 159..228 CDD:197706 22/76 (29%)
Ig 244..337 CDD:299845 23/94 (24%)
I-set 244..337 CDD:254352 23/94 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.