DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAM and rst

DIOPT Version :9

Sequence 1:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:792 Identity:162/792 - (20%)
Similarity:250/792 - (31%) Gaps:283/792 - (35%)


- Green bases have known domain annotations that are detailed below.


Human   514 TAIAGRDTYIHCRVIGYPYYSIKWYKNS-------NLLPF-NHRQVAFENNGTLKLSDVQKEV-- 568
            ||:.|....:.||||. ...:::|.|:.       :|..| .:..|..:..|...| |:...:  
  Fly    38 TAVVGARVTLPCRVIN-KQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDYSL-DIYPVMLD 100

Human   569 DEGEYTCNVLVQPQ---LSTSQSVHVTVKVPPFIQPFEFPRFSIG--------QRVFIPCVVVSG 622
            |:..|.|.|...|:   ...|....:||.|||     |.|:.:.|        ::|.|.||.|.|
  Fly   101 DDARYQCQVSPGPEGQPAIRSTFAGLTVLVPP-----EAPKITQGDVIYATEDRKVEIECVSVGG 160

Human   623 DLPITITWQKDGRPIPGSLGVTIDNIDFT-------------SSLRISNLSLMHNGNYTCIARNE 674
            .....|||      |.|...|..|||::|             |.||::.....||.|::|.|:|.
  Fly   161 KPAAEITW------IDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNT 219

Human   675 A-------------------------------------------------AAVEH---------- 680
            |                                                 ..|||          
  Fly   220 ADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRAD 284

Human   681 ---------------------QSQLIVR-------------------------------VPPKFV 693
                                 ::::::|                               ..|.|.
  Fly   285 ANPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSETLDISYAPSFR 349

Human   694 VQPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQ-----VLSNGSLLI 753
            .:|:..:...|..|.|.|..:..|.|.|||                   ||     |:...:.|.
  Fly   350 QRPQSMEADVGSVVSLTCEVDSNPQPEIVW-------------------IQHPSDRVVGTSTNLT 395

Human   754 KHVVEEDSGYYLCKVSNDVGADVSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHG-EKPI 817
            ..|..|.:|.|.||.:....|::|...|:.:|....|.| ..|.....|....:.|.|.. .:..
  Fly   396 FSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGS-QRTQYGLVGDTARIECFASSVPRAR 459

Human   818 IVRWEKEDRIINPEMAR-YLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSYGEDRGIIQLT 881
            .|.|....:.|:.|... |.:....|...|.|||.|..:.....|.::|..:|.||.|...|||.
  Fly   460 HVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQ 524

Human   882 VQEPPDPPEIEIKDVKARTITLRWTMGFDGNSPITGY----------DIECKNK-----SDSWDS 931
            .:               ::::|..|:  .|...:..:          .|:||.:     :|....
  Fly   525 AK---------------KSVSLLMTI--VGGISVVAFLLVLTILVVVYIKCKKRTKLPPADVISE 572

Human   932 AQRTKD--VSPQLN--------SATIIDI------------HPS------STYSIRMYAKNRIGK 968
            .|.||:  ||.:|.        |...:||            |.|      :|.|.:....:.|.:
  Fly   573 HQITKNGGVSCKLEPGDRTSNYSDLKVDISGGYVPYGDYSTHYSPPPQYLTTCSTKSNGSSTIMQ 637

Human   969 SEPSNELTITADEAAPDGPPQEVHLEPISSQSIRVTWKAPKKHLQNGIIRGYQIGYREYSTGGNF 1033
            :...|:|.:...:       |:.|     .|....|...|...|.|             |:||:.
  Fly   638 NNHQNQLQLQQQQ-------QQSH-----HQHHTQTTTLPMTFLTN-------------SSGGSL 677

Human  1034 QFNIISVDTSGDSEVYTLDNLNKF--TQYGLVVQACNRAGTGPSSQEIITTTLE-DVPSYPPENV 1095
            ..:||     |..|:...:.|...  |...:|..:.|.:.:..|:....|||.. .|||     .
  Fly   678 TGSII-----GSREIRQDNGLPSLQSTTASVVSSSPNGSCSNQSTTAATTTTTHVVVPS-----S 732

Human  1096 QAIATSPESISI 1107
            .|::..|...:|
  Fly   733 MALSVDPRYSAI 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352
I-set 315..385 CDD:333254
Ig_3 407..488 CDD:316449
IGc2 518..575 CDD:197706 15/66 (23%)
I-set 596..686 CDD:333254 34/190 (18%)
Ig_DSCAM 707..784 CDD:143211 21/81 (26%)
Ig 802..889 CDD:325142 23/88 (26%)
FN3 885..978 CDD:238020 23/135 (17%)
FN3 986..1083 CDD:238020 20/98 (20%)
FN3 1091..1184 CDD:238020 3/17 (18%)
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
rstNP_001284835.1 IG_like 34..130 CDD:214653 23/93 (25%)
Ig 42..114 CDD:299845 17/73 (23%)
C2-set_2 135..225 CDD:285423 28/95 (29%)
Ig_3 265..329 CDD:290638 4/63 (6%)
I-set 346..420 CDD:254352 23/92 (25%)
Ig 360..425 CDD:299845 22/83 (27%)
Ig5_KIRREL3-like 428..524 CDD:143235 25/96 (26%)
IG_like 435..524 CDD:214653 23/88 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.